Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (16 Oct 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein FAM126B

Gene

Fam126b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM126B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fam126b
Synonyms:D1Ertd53e
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1098784 Fam126b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002780951 – 530Protein FAM126BAdd BLAST530

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei30PhosphothreonineBy similarity1
Modified residuei306PhosphothreonineCombined sources1
Modified residuei321PhosphoserineBy similarity1
Modified residuei341PhosphoserineCombined sources1
Modified residuei430PhosphoserineCombined sources1
Modified residuei442PhosphoserineCombined sources1
Modified residuei444PhosphoserineBy similarity1
Modified residuei491PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8C729

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8C729

PeptideAtlas

More...
PeptideAtlasi
Q8C729

PRoteomics IDEntifications database

More...
PRIDEi
Q8C729

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8C729

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8C729

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8C729

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the central nervous system. Expressed at much lower level in oligodendrocytes than in neurons.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000038174 Expressed in 291 organ(s), highest expression level in nucleus of brain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8C729 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8C729 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a phosphatidylinositol 4-kinase (PI4K) complex, composed of PI4KA, EFR3 (EFR3A or EFR3B), TTC7 (TTC7A or TTC7B) and FAM126 (FAM126A or FAM126B).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000123728

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM126 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4688 Eukaryota
ENOG410ZXRB LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011295

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000252938

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8C729

KEGG Orthology (KO)

More...
KOi
K21844

Identification of Orthologs from Complete Genome Data

More...
OMAi
KRWKEHC

Database of Orthologous Groups

More...
OrthoDBi
673408at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8C729

TreeFam database of animal gene trees

More...
TreeFami
TF317153

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018619 Hyccin

The PANTHER Classification System

More...
PANTHERi
PTHR31220 PTHR31220, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09790 Hyccin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C729-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGSERAVVE EWLSEFKALP DTQITSYAAT LHRKKALVPA LYKVIQDSNN
60 70 80 90 100
ELLEPVCHQL FELYRSSEVR LKRFTLQFLP ELIWVYLRLT VSRDRQSNGC
110 120 130 140 150
IEALLLGIYN LEIADKDGNN KVLSFTIPSL SKPSIYHEPS TIGSMALTEG
160 170 180 190 200
ALCQHDLIRV VYSDLHPQRE TFTAQNRFEV LSFLMLCYNS AIVYMPASSY
210 220 230 240 250
QSLCRMGSRV CVSGFPRQHE KQWKELCGRI VLDPEFMVQL LTGVYYAMYN
260 270 280 290 300
GQWDLGQEVL DDIIYRAQLE LFSQPLLVAN AMKNSLPFDA PDSSQEGQKV
310 320 330 340 350
LKVEVTPTVP RISRTAITTA SIRRHRWRRE GAEGLNGGEE SLNMNDADEG
360 370 380 390 400
FSSGASLSSQ PHGTKPPSSS QRGSLRKVAT GRSAKDKETA LAIKSNESPR
410 420 430 440 450
DSVVGKQFVQ QQADLSIDSV ELTPMKKHLS LPAGQVVPKT NSLSLIRTAS
460 470 480 490 500
ASSSKSFDYV NGGQASTSIG VGTEGVTNLA ATNANRYSTI SLQEDRLGHA
510 520 530
GEGKELLSPG APLTKQSRSP SFNMQLISQV
Length:530
Mass (Da):58,587
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7C57D7C10D047FD7
GO
Isoform 2 (identifier: Q8C729-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     330-330: E → EDGFDFSNEADSSIPGSPIQHGSTDLGIKRVQEGEVLVRRTPEHGSPEPTSAAATTE

Note: No experimental confirmation available.
Show »
Length:586
Mass (Da):64,448
Checksum:i1F6BE0B1CB50C398
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CZ67E0CZ67_MOUSE
Protein FAM126B
Fam126b
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WSI2A0A087WSI2_MOUSE
Protein FAM126B
Fam126b
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti239Q → R in AAH68302 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035078330E → EDGFDFSNEADSSIPGSPIQ HGSTDLGIKRVQEGEVLVRR TPEHGSPEPTSAAATTE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK052638 mRNA Translation: BAC35073.1
AK144602 mRNA Translation: BAE25961.1
AK168372 mRNA Translation: BAE40304.1
BC068302 mRNA Translation: AAH68302.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14976.1 [Q8C729-1]
CCDS78588.1 [Q8C729-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001297527.1, NM_001310598.1 [Q8C729-2]
NP_001297528.1, NM_001310599.1 [Q8C729-1]
NP_766101.3, NM_172513.3 [Q8C729-1]
XP_006495895.1, XM_006495832.2 [Q8C729-2]
XP_006495896.1, XM_006495833.2 [Q8C729-2]
XP_017175146.1, XM_017319657.1 [Q8C729-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000038372; ENSMUSP00000038718; ENSMUSG00000038174 [Q8C729-1]
ENSMUST00000097724; ENSMUSP00000095331; ENSMUSG00000038174 [Q8C729-2]
ENSMUST00000161600; ENSMUSP00000123728; ENSMUSG00000038174 [Q8C729-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
213056

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:213056

UCSC genome browser

More...
UCSCi
uc007bch.2 mouse [Q8C729-1]
uc007bcj.2 mouse [Q8C729-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK052638 mRNA Translation: BAC35073.1
AK144602 mRNA Translation: BAE25961.1
AK168372 mRNA Translation: BAE40304.1
BC068302 mRNA Translation: AAH68302.1
CCDSiCCDS14976.1 [Q8C729-1]
CCDS78588.1 [Q8C729-2]
RefSeqiNP_001297527.1, NM_001310598.1 [Q8C729-2]
NP_001297528.1, NM_001310599.1 [Q8C729-1]
NP_766101.3, NM_172513.3 [Q8C729-1]
XP_006495895.1, XM_006495832.2 [Q8C729-2]
XP_006495896.1, XM_006495833.2 [Q8C729-2]
XP_017175146.1, XM_017319657.1 [Q8C729-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000123728

PTM databases

iPTMnetiQ8C729
PhosphoSitePlusiQ8C729
SwissPalmiQ8C729

Proteomic databases

EPDiQ8C729
PaxDbiQ8C729
PeptideAtlasiQ8C729
PRIDEiQ8C729

Genome annotation databases

EnsembliENSMUST00000038372; ENSMUSP00000038718; ENSMUSG00000038174 [Q8C729-1]
ENSMUST00000097724; ENSMUSP00000095331; ENSMUSG00000038174 [Q8C729-2]
ENSMUST00000161600; ENSMUSP00000123728; ENSMUSG00000038174 [Q8C729-1]
GeneIDi213056
KEGGimmu:213056
UCSCiuc007bch.2 mouse [Q8C729-1]
uc007bcj.2 mouse [Q8C729-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
285172
MGIiMGI:1098784 Fam126b

Phylogenomic databases

eggNOGiKOG4688 Eukaryota
ENOG410ZXRB LUCA
GeneTreeiENSGT00390000011295
HOGENOMiHOG000252938
InParanoidiQ8C729
KOiK21844
OMAiKRWKEHC
OrthoDBi673408at2759
PhylomeDBiQ8C729
TreeFamiTF317153

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fam126b mouse

Protein Ontology

More...
PROi
PR:Q8C729

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000038174 Expressed in 291 organ(s), highest expression level in nucleus of brain
ExpressionAtlasiQ8C729 baseline and differential
GenevisibleiQ8C729 MM

Family and domain databases

InterProiView protein in InterPro
IPR018619 Hyccin
PANTHERiPTHR31220 PTHR31220, 1 hit
PfamiView protein in Pfam
PF09790 Hyccin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF126B_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8C729
Secondary accession number(s): Q3UMY7, Q6NV64
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: March 1, 2003
Last modified: October 16, 2019
This is version 109 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again