Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 91 (08 May 2019)
Sequence version 4 (04 Feb 2015)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cilia- and flagella-associated protein 54

Gene

Cfap54

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for assembly and function of cilia and flagella (PubMed:26224312).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation, Differentiation, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cilia- and flagella-associated protein 54Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cfap54Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1922208 Cfap54

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Deficient mice shown hydrocephalus, male infertility, and accumulation of mucus in the sinus cavity. The male infertility is due to severe defects in spermatid flagellar formation.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003246071 – 3106Cilia- and flagella-associated protein 54Add BLAST3106

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8C6S9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8C6S9

PeptideAtlas

More...
PeptideAtlasi
Q8C6S9

PRoteomics IDEntifications database

More...
PRIDEi
Q8C6S9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8C6S9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8C6S9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high level in the testis and at a low level in the lung and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020014 Expressed in 112 organ(s), highest expression level in adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8C6S9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8C6S9 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000129517

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CFAP54 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IECN Eukaryota
ENOG410ZUA4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162446

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000171091

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8C6S9

Database of Orthologous Groups

More...
OrthoDBi
31951at2759

TreeFam database of animal gene trees

More...
TreeFami
TF328826

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027912 CFAP54

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14858 DUF4486, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C6S9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSRSSSSS SEESPDSETS VSPVHLPPTP PPTSTAVLKS PSESKSSSTD
60 70 80 90 100
PPQCTHSEDS LPSAAFYGPL DSKNPLLASC EKEIRELLGF MKKKKALATS
110 120 130 140 150
MEQKYEFHRR CATTLFNIWT KYAPRLPSNY YNEKLLKVGD SLCQIKEYKL
160 170 180 190 200
ALLQCYGRYL QEFIADFDEH KEDVNHFKTV FFPKGFGDET ARLTFHALSG
210 220 230 240 250
KNICNYQLVC ESDANLQNEE SVRQCLHILS SFRLIMQVAL PQEHLCWIIF
260 270 280 290 300
NGTLYIYTIC RKLMVIGQSS KALEFLLWAS MCMESSVPLL SIRYLTWRAT
310 320 330 340 350
LYTAVCQCHY DCQDGIHGEA FARRALAKID ELRQLELMSS SSSLETSRKY
360 370 380 390 400
YREATIKMAV MIFKRGVFES RRKNKNVLRP KLRLNLKEAQ SLPWPRTVTE
410 420 430 440 450
RLLDELLDST SSRFLAVLEA LSDSNRRILQ TGPLVTDEME LRDVVSELFM
460 470 480 490 500
AGKELLILSN VRSNGKLDFP QTSLLEHVVE KRNALSVGAS VRFAKLAFTY
510 520 530 540 550
EEWGLFESLA GQLIHFLQKQ DNPQSKKAEK DLILLLAVEP LINVKRNRGL
560 570 580 590 600
IFPLETDKET QSIENYLKHI ACHESCMRTT FTEDTFSLAA ILHFCVCVPT
610 620 630 640 650
QGVLPDKDIV VDIIGLLWQR CKLGIQRLNI PKNDFAKYSH KISTNKWVYL
660 670 680 690 700
LWQISEVIHC YKLEDLDIVM VAEITLRLSE ILESLGSPKR KFKKSADLSA
710 720 730 740 750
KKGPDELPGT SKGVPEILPI LKRAPVEQLF YAYELLDKAI IGMSWKCMLT
760 770 780 790 800
TLSDGSSVID HCYVKDSQDV DGDTYKPIAS NSYTMDLHLE LIQAQHRIAV
810 820 830 840 850
VLLDQLEVLQ APTVSTNTPA KGWEKVKKPR STECFTELTV MKKIKKNKLS
860 870 880 890 900
KAIYLMQKAL LLFEKDAVCE TSRNLLMEAN ALIEKVEAEQ NALYSYQKFL
910 920 930 940 950
GSSKIKKSRI PPPPILLART HCSVTLKPAP FISEVKASWY CILGCKADGS
960 970 980 990 1000
YGKVRLNNNH LPNSGEAIPA DGRSFFEIKG LETNAQYCFA IAAYSSSGKL
1010 1020 1030 1040 1050
IGDAIGETTK PILIYPPLSA VTARMYLTQV AYQIGNYEMA KKVFSPVWDY
1060 1070 1080 1090 1100
FVASPLPDEQ SVICLSNIMT ITQKRLHSNI LADTSSILLY LFLRNIFVMS
1110 1120 1130 1140 1150
DIKIKEENLF CDNIKGNEIF PAQQVARLVE CENVLVALEL SNFLNDANFA
1160 1170 1180 1190 1200
LQAVTQCYGL LAPIIYHNIV LVPVIQILIK CIVVLQGIPS IIHSKKNISS
1210 1220 1230 1240 1250
FESIQHMIAC CIFYMTKILR SWKEYDLAIM LINYGKKMLD ITSGCRSLFG
1260 1270 1280 1290 1300
IEQEETAEEG VCSKKTSRTK KPQQVLLPEK INEQLALLET HLLKTTKQIN
1310 1320 1330 1340 1350
SAELSGSEDP IFLYPIVLNW TVKGAMKEVM KFKQRPRFLE FFTQIMLKCM
1360 1370 1380 1390 1400
NDEKFHLMVE ISAPVYDFLK RRNESLIGVK RIKYKETVIS RRALKSPSKF
1410 1420 1430 1440 1450
KAIVIEIGKS SDLTRRRRKK KKTLKDFFYK NPSIFDMAEL DRNKRTDVRK
1460 1470 1480 1490 1500
MAYRSLSDNL NPLILTYVRR KRFHQILLEE LPWRAQMNLY LANAHFHLFL
1510 1520 1530 1540 1550
QKLTERTKER LGSSYSSVSF RSCDPNLFSL FHSGTVLPTA KLTVDSYNAM
1560 1570 1580 1590 1600
MDALTVSKKK KHNQTTDTED LSVLFNSKSD DNIPKMKTQT IYESDSQLGI
1610 1620 1630 1640 1650
GVNVREKDRT LVWGLDHFMK IFLCCRRAMV LAYRGGYWTL LQNCCRVFWN
1660 1670 1680 1690 1700
FSRELQILLK QTVASCKTFP VSQDNFLCIC VLPFYLGAEL LIDMLIKLQS
1710 1720 1730 1740 1750
TNSIKPFEER GEFSIPSCYG NIKSDNGGSS LIFEHPLDDV NVVDLRWIHD
1760 1770 1780 1790 1800
FVLKSLEVLY QVEKWETLVS LAIQFNIISH ERYTEQVTPL LVYAQRQLVQ
1810 1820 1830 1840 1850
RIKELNGPEL SRQACARYEA ENGEKITCRN FIGKRLKIDS STPKNLAELQ
1860 1870 1880 1890 1900
GSSEPLKTLI TSEQRLAKQL VSVPLDVNDT LRCFRETLEK SKYHNRSVRH
1910 1920 1930 1940 1950
SRKLLSLFLA QTQDVLQTSN QRSLKVQSLH SLGSLLLFAD KKRAAFKCWS
1960 1970 1980 1990 2000
QALDDIFRKP DVLHNWKEFG TSLPGAPSSS SPPGFKDYSE EFLSKFGIWG
2010 2020 2030 2040 2050
CLQAAMITAK IAQFIKTANV KKRINCCILS ALLFQSLLRT TLPHPKAERN
2060 2070 2080 2090 2100
YAQYEITQLL PGIELFSDKF RADICSVIAS LYYVIRELHY AKYNLIVLPL
2110 2120 2130 2140 2150
LALYQYFVSV ICQDIVRNLE ARILKIEILI DLGFFSEAFY ELFQIYHGKN
2160 2170 2180 2190 2200
MPCAIPAGYK ATMKVKITQS FDSGKPLTHK DNMQALEELI NRGLPHILVN
2210 2220 2230 2240 2250
LGYQHLLNKF NFAKSHFFIS LAATINCIPD PSPKIMYYQF ITERSKPTPQ
2260 2270 2280 2290 2300
NLKDNENSHG QFLRLRDDYN LNTIKSILLM EAEEKVNSLL SETEHQCHRP
2310 2320 2330 2340 2350
LYLSSVLELE IMVEARLHLA AIALQRYRPA YSTAILYSTL KLLQDSKVFK
2360 2370 2380 2390 2400
KKVPEESCSP TSPETSTTES KDDSEFLDPI SLNSREYFNI HLWLRCRLML
2410 2420 2430 2440 2450
VTSFIAQIRG IGIMKESELT DCLSLIDEVC TEAKSADDTE VLAEFLMQAV
2460 2470 2480 2490 2500
VLGLQEKHFK ADIIQKLKEI ISLLEGSEFL SPRSWLTLAK SLILMDDLTK
2510 2520 2530 2540 2550
AEKFKKASSK ENKLIFLNQA HRILIAQMLT FGETIEFPLS DSDYASPLQP
2560 2570 2580 2590 2600
LKNIYLPHVM LLAKVKLRIG HTMAKQVCSS SKKKDISKWL PVLHMFDMAL
2610 2620 2630 2640 2650
KVCKATAAEE YEVEAEILFQ KGRIERQMLM EEKTSIAHIE SFFEAIQISL
2660 2670 2680 2690 2700
KNDQNSGLIR DSYLEIALVY FYLKKPKRKA SATTLKPLPR RHSSVKDPVA
2710 2720 2730 2740 2750
TQTEMYSSLA WIAIRAAAQV SESVLGINLL IGKKRAMIDK VNNITLPNIP
2760 2770 2780 2790 2800
EFATVDLLSS YTDYLLENYQ VVFQTSNSLM CENDDVYDCI DGRKRNLSKV
2810 2820 2830 2840 2850
DVTWILLIRY YIHLQRINNM SKLLASATPV SGISLPDDTL LTSLYNSELI
2860 2870 2880 2890 2900
LRQKEMHLFL KRFLQLYSSS CIDGFPRELL QGLENISLEK VLFESSGKVH
2910 2920 2930 2940 2950
RDSSLQSDLS GKLTVCPSYT EISSEMAVQA LNKELCFQWY IPPLDKPLKD
2960 2970 2980 2990 3000
SEPMVLLLYA YNLKPLRILD IKVSTGNSLY VGTSWIPLRS VIAVHQKLSN
3010 3020 3030 3040 3050
LAQIAEISLP SVPEVTSEEN IYETIEPEDK PIDTDLENMI LECCSEIEAL
3060 3070 3080 3090 3100
FSNNKDKDNE PPPPMTKVPF DVSLPAIFSL ERLFDLANGC IVSVGSLFNW

MVSIIQ
Length:3,106
Mass (Da):353,760
Last modified:February 4, 2015 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i77DBF017CCCBA7F3
GO
Isoform 2 (identifier: Q8C6S9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1913-1913: Q → QDERGGMDNSKFTPGKVEFCLGTEEMHMPTPPDLSQENFRVFSSVEKSKLPSSQLGLVISSYYQTI

Show »
Length:3,171
Mass (Da):361,014
Checksum:i9A805F2735DCBF87
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PZY5E9PZY5_MOUSE
Cilia- and flagella-associated prot...
Cfap54
598Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T8I5A0A140T8I5_MOUSE
Cilia- and flagella-associated prot...
Cfap54
816Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6V4L0F6V4L0_MOUSE
Cilia- and flagella-associated prot...
Cfap54 4930485B16Rik
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6SXY8F6SXY8_MOUSE
Cilia- and flagella-associated prot...
Cfap54
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Z1L4F6Z1L4_MOUSE
Cilia- and flagella-associated prot...
Cfap54
314Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P752A0A1W2P752_MOUSE
Cilia- and flagella-associated prot...
Cfap54
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1STN0A0A1L1STN0_MOUSE
Cilia- and flagella-associated prot...
Cfap54
312Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14S → F in BAC35315 (PubMed:16141072).Curated1
Sequence conflicti94K → R in BAC35315 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0581201913Q → QDERGGMDNSKFTPGKVEFC LGTEEMHMPTPPDLSQENFR VFSSVEKSKLPSSQLGLVIS SYYQTI in isoform 2. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
KM983399 mRNA Translation: AKN79615.1
AC122326 Genomic DNA No translation available.
AC162939 Genomic DNA No translation available.
AC168049 Genomic DNA No translation available.
AK053219 mRNA Translation: BAC35315.1

NCBI Reference Sequences

More...
RefSeqi
NP_001333989.1, NM_001347060.1 [Q8C6S9-2]
XP_011241942.1, XM_011243640.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000168110; ENSMUSP00000129517; ENSMUSG00000020014 [Q8C6S9-1]
ENSMUST00000212902; ENSMUSP00000148636; ENSMUSG00000020014 [Q8C6S9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
380654

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:380654

UCSC genome browser

More...
UCSCi
uc007guh.1 mouse [Q8C6S9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
KM983399 mRNA Translation: AKN79615.1
AC122326 Genomic DNA No translation available.
AC162939 Genomic DNA No translation available.
AC168049 Genomic DNA No translation available.
AK053219 mRNA Translation: BAC35315.1
RefSeqiNP_001333989.1, NM_001347060.1 [Q8C6S9-2]
XP_011241942.1, XM_011243640.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000129517

PTM databases

iPTMnetiQ8C6S9
PhosphoSitePlusiQ8C6S9

Proteomic databases

MaxQBiQ8C6S9
PaxDbiQ8C6S9
PeptideAtlasiQ8C6S9
PRIDEiQ8C6S9

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000168110; ENSMUSP00000129517; ENSMUSG00000020014 [Q8C6S9-1]
ENSMUST00000212902; ENSMUSP00000148636; ENSMUSG00000020014 [Q8C6S9-2]
GeneIDi380654
KEGGimmu:380654
UCSCiuc007guh.1 mouse [Q8C6S9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
144535
MGIiMGI:1922208 Cfap54

Phylogenomic databases

eggNOGiENOG410IECN Eukaryota
ENOG410ZUA4 LUCA
GeneTreeiENSGT00940000162446
HOGENOMiHOG000171091
InParanoidiQ8C6S9
OrthoDBi31951at2759
TreeFamiTF328826

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8C6S9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020014 Expressed in 112 organ(s), highest expression level in adrenal gland
ExpressionAtlasiQ8C6S9 baseline and differential
GenevisibleiQ8C6S9 MM

Family and domain databases

InterProiView protein in InterPro
IPR027912 CFAP54
PfamiView protein in Pfam
PF14858 DUF4486, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCFA54_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8C6S9
Secondary accession number(s): A0A0K0NTX9, D3Z3Q2, E9PUV7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: February 4, 2015
Last modified: May 8, 2019
This is version 91 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again