Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Succinate dehydrogenase assembly factor 2, mitochondrial

Gene

Sdhaf2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SDHA of the SDH catalytic dimer.UniRule annotation

GO - Biological processi

Keywordsi

Molecular functionChaperone

Names & Taxonomyi

Protein namesi
Recommended name:
Succinate dehydrogenase assembly factor 2, mitochondrialUniRule annotation
Short name:
SDH assembly factor 2UniRule annotation
Short name:
SDHAF2UniRule annotation
Gene namesi
Name:Sdhaf2UniRule annotation
Synonyms:Pgl2UniRule annotation, Sdh5UniRule annotation
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1913322 Sdhaf2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 27MitochondrionSequence analysisAdd BLAST27
ChainiPRO_000029435828 – 164Succinate dehydrogenase assembly factor 2, mitochondrialAdd BLAST137

Proteomic databases

EPDiQ8C6I2
PaxDbiQ8C6I2
PeptideAtlasiQ8C6I2
PRIDEiQ8C6I2

PTM databases

iPTMnetiQ8C6I2
PhosphoSitePlusiQ8C6I2

Expressioni

Gene expression databases

BgeeiENSMUSG00000024668 Expressed in 285 organ(s), highest expression level in cochlea
CleanExiMM_0610038F07RIK
GenevisibleiQ8C6I2 MM

Interactioni

Subunit structurei

Interacts with SDHA within the SDH catalytic dimer.UniRule annotation

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025570

Structurei

3D structure databases

ProteinModelPortaliQ8C6I2
SMRiQ8C6I2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SDHAF2 family.UniRule annotation

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3326 Eukaryota
COG2938 LUCA
GeneTreeiENSGT00390000001149
HOGENOMiHOG000230636
InParanoidiQ8C6I2
KOiK18168
OMAiIYYWATD
OrthoDBiEOG091G0VSZ
PhylomeDBiQ8C6I2
TreeFamiTF300175

Family and domain databases

Gene3Di1.10.150.250, 1 hit
HAMAPiMF_03057 SDHAF2, 1 hit
InterProiView protein in InterPro
IPR005631 SDH
IPR036714 SDH_sf
IPR028882 SDHAF2
PfamiView protein in Pfam
PF03937 Sdh5, 1 hit
SUPFAMiSSF109910 SSF109910, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8C6I2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVVTLIPTL ARALSKHSLL SPLPSVTSFR RFYRGDSPTD SQKDMIEIPL
60 70 80 90 100
PPWQERTDES IETKRARLLY ESRKRGMLEN CILLSLFAKE YLHNMTEKQL
110 120 130 140 150
NLYDRLINEP SNDWDIYYWA TEAKPAPEIF ENEVMELLRE FAKNKNKEQR
160
LRAPDLEYLF EKPH
Length:164
Mass (Da):19,431
Last modified:March 1, 2003 - v1
Checksum:iCDC12D451D532BA4
GO
Isoform 2 (identifier: Q8C6I2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-164: EAKPAPEIFENEVMELLREFAKNKNKEQRLRAPDLEYLFEKPH → GMPYAELHLGIIR

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):15,702
Checksum:i47578142A53EB5C0
GO
Isoform 3 (identifier: Q8C6I2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: Missing.

Note: No experimental confirmation available.
Show »
Length:70
Mass (Da):8,574
Checksum:i11F13375979B4CD9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27T → K in BAB28863 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0266331 – 94Missing in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_026634122 – 164EAKPA…FEKPH → GMPYAELHLGIIR in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK160175 mRNA Translation: BAE35674.1
AK013454 mRNA Translation: BAB28863.1
AK075594 mRNA Translation: BAC35843.1
AK160957 mRNA Translation: BAE36113.1
AK167228 mRNA Translation: BAE39352.1
BC029630 mRNA Translation: AAH29630.1
BC038924 mRNA Translation: AAH38924.1
BC048913 mRNA Translation: AAH48913.1
BC060090 mRNA Translation: AAH60090.1
BC085277 mRNA Translation: AAH85277.1
CCDSiCCDS29578.1 [Q8C6I2-1]
RefSeqiNP_079609.2, NM_025333.4 [Q8C6I2-1]
UniGeneiMm.180063
Mm.490260

Genome annotation databases

EnsembliENSMUST00000025570; ENSMUSP00000025570; ENSMUSG00000024668 [Q8C6I2-1]
GeneIDi66072
KEGGimmu:66072
UCSCiuc008gpt.2 mouse [Q8C6I2-1]
uc008gpv.1 mouse [Q8C6I2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK160175 mRNA Translation: BAE35674.1
AK013454 mRNA Translation: BAB28863.1
AK075594 mRNA Translation: BAC35843.1
AK160957 mRNA Translation: BAE36113.1
AK167228 mRNA Translation: BAE39352.1
BC029630 mRNA Translation: AAH29630.1
BC038924 mRNA Translation: AAH38924.1
BC048913 mRNA Translation: AAH48913.1
BC060090 mRNA Translation: AAH60090.1
BC085277 mRNA Translation: AAH85277.1
CCDSiCCDS29578.1 [Q8C6I2-1]
RefSeqiNP_079609.2, NM_025333.4 [Q8C6I2-1]
UniGeneiMm.180063
Mm.490260

3D structure databases

ProteinModelPortaliQ8C6I2
SMRiQ8C6I2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025570

PTM databases

iPTMnetiQ8C6I2
PhosphoSitePlusiQ8C6I2

Proteomic databases

EPDiQ8C6I2
PaxDbiQ8C6I2
PeptideAtlasiQ8C6I2
PRIDEiQ8C6I2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000025570; ENSMUSP00000025570; ENSMUSG00000024668 [Q8C6I2-1]
GeneIDi66072
KEGGimmu:66072
UCSCiuc008gpt.2 mouse [Q8C6I2-1]
uc008gpv.1 mouse [Q8C6I2-2]

Organism-specific databases

CTDi54949
MGIiMGI:1913322 Sdhaf2

Phylogenomic databases

eggNOGiKOG3326 Eukaryota
COG2938 LUCA
GeneTreeiENSGT00390000001149
HOGENOMiHOG000230636
InParanoidiQ8C6I2
KOiK18168
OMAiIYYWATD
OrthoDBiEOG091G0VSZ
PhylomeDBiQ8C6I2
TreeFamiTF300175

Miscellaneous databases

PROiPR:Q8C6I2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024668 Expressed in 285 organ(s), highest expression level in cochlea
CleanExiMM_0610038F07RIK
GenevisibleiQ8C6I2 MM

Family and domain databases

Gene3Di1.10.150.250, 1 hit
HAMAPiMF_03057 SDHAF2, 1 hit
InterProiView protein in InterPro
IPR005631 SDH
IPR036714 SDH_sf
IPR028882 SDHAF2
PfamiView protein in Pfam
PF03937 Sdh5, 1 hit
SUPFAMiSSF109910 SSF109910, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSDHF2_MOUSE
AccessioniPrimary (citable) accession number: Q8C6I2
Secondary accession number(s): Q3TVE5
, Q6PAS5, Q80ZJ9, Q8K2W8, Q9CYQ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: September 12, 2018
This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again