Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Septin-10

Gene

Sept10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential).By similarityCurated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei101GTP; via amide nitrogenBy similarity1
Binding sitei236GTP; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei251GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi46 – 53GTPBy similarity8
Nucleotide bindingi182 – 190GTPBy similarity9

GO - Molecular functioni

  • GTPase activity Source: GO_Central
  • GTP binding Source: UniProtKB-KW
  • protein-containing complex scaffold activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division
LigandGTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-10
Gene namesi
Name:Sept10
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1918110 Sept10

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001735391 – 452Septin-10Add BLAST452

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei414PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8C650
PeptideAtlasiQ8C650
PRIDEiQ8C650

2D gel databases

REPRODUCTION-2DPAGEiIPI00606459

PTM databases

iPTMnetiQ8C650
PhosphoSitePlusiQ8C650

Expressioni

Gene expression databases

CleanExiMM_SEPT10

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ8C650, 1 interactor
STRINGi10090.ENSMUSP00000129023

Structurei

3D structure databases

ProteinModelPortaliQ8C650
SMRiQ8C650
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 302Septin-type GPROSITE-ProRule annotationAdd BLAST267

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni46 – 53G1 motifPROSITE-ProRule annotation8
Regioni98 – 101G3 motifPROSITE-ProRule annotation4
Regioni181 – 184G4 motifPROSITE-ProRule annotation4

Sequence similaritiesi

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ8C650
KOiK16940
PhylomeDBiQ8C650
TreeFamiTF101080

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C650-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASCDEIKEH PRSLSMCGHV GFESLPDQLV DRSIEQGFCF NILCVGETGI
60 70 80 90 100
GKSTLINTLF NTNFEELESS HFCPCVRLRA QTYELQESNV RLKLTIVNTV
110 120 130 140 150
GFGDQINKED SYQPIVDYID DQFEAYLQEE VKIKRALFNY HDSRIHVCLY
160 170 180 190 200
FIAPTGHSLR TLDLLTMKSL DNKVNIIPLI AKADTISKSE LQKFKMKLMN
210 220 230 240 250
ELVINGVQIY QFPTDDDTTS KINGAMNGHL PFAVVGSMDE IKVGNKMVKG
260 270 280 290 300
RQYPWGIVQV ENENHCDFVK LREMLICTNM EDLREQTHMR HYELYRRCKL
310 320 330 340 350
QEMGFVDMGP ENKPLSLQET YEAKRHEFYG ERQRKEEQMK QMFVQRVKEK
360 370 380 390 400
EAILKEAERE LQAKFEHLKR IHQEERMKLE EKRRMLEEES VAFAKKKATC
410 420 430 440 450
ELFPNQSFLA SGSSIRKDKD RKKADGASAF CDCLTAQESV RLCISSPRKD

MD
Length:452
Mass (Da):52,422
Last modified:March 1, 2003 - v1
Checksum:i8F84584555289072
GO
Isoform 2 (identifier: Q8C650-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-452: KADGASAFCDCLTAQESVRLCISSPRKDMD → NSNFM

Note: No experimental confirmation available.
Show »
Length:427
Mass (Da):49,815
Checksum:i861969B3A5987259
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J233A0A0R4J233_MOUSE
Septin-10
Sept10
427Annotation score:
A0A1W2P6J7A0A1W2P6J7_MOUSE
Septin-10
Sept10 mCG_19014
452Annotation score:
A0A1W2P866A0A1W2P866_MOUSE
Septin-10
Sept10
196Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti131V → L in AAH53752 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014093423 – 452KADGA…RKDMD → NSNFM in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076569 mRNA Translation: BAC36397.1
BC053752 mRNA Translation: AAH53752.1
CCDSiCCDS48566.1 [Q8C650-2]
RefSeqiNP_001020081.2, NM_001024910.3
NP_001020082.1, NM_001024911.2
UniGeneiMm.346842
Mm.397041

Genome annotation databases

GeneIDi103080
KEGGimmu:103080
UCSCiuc007fdm.1 mouse [Q8C650-1]
uc007fdn.2 mouse [Q8C650-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076569 mRNA Translation: BAC36397.1
BC053752 mRNA Translation: AAH53752.1
CCDSiCCDS48566.1 [Q8C650-2]
RefSeqiNP_001020081.2, NM_001024910.3
NP_001020082.1, NM_001024911.2
UniGeneiMm.346842
Mm.397041

3D structure databases

ProteinModelPortaliQ8C650
SMRiQ8C650
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8C650, 1 interactor
STRINGi10090.ENSMUSP00000129023

PTM databases

iPTMnetiQ8C650
PhosphoSitePlusiQ8C650

2D gel databases

REPRODUCTION-2DPAGEiIPI00606459

Proteomic databases

PaxDbiQ8C650
PeptideAtlasiQ8C650
PRIDEiQ8C650

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi103080
KEGGimmu:103080
UCSCiuc007fdm.1 mouse [Q8C650-1]
uc007fdn.2 mouse [Q8C650-2]

Organism-specific databases

CTDi151011
MGIiMGI:1918110 Sept10

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
HOGENOMiHOG000233586
HOVERGENiHBG065093
InParanoidiQ8C650
KOiK16940
PhylomeDBiQ8C650
TreeFamiTF101080

Miscellaneous databases

PROiPR:Q8C650
SOURCEiSearch...

Gene expression databases

CleanExiMM_SEPT10

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSEP10_MOUSE
AccessioniPrimary (citable) accession number: Q8C650
Secondary accession number(s): Q7TSA5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 117 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again