Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein U

Gene

Cenpu

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Plays an important role in the correct PLK1 localization to the mitotic kinetochores. A scaffold protein responsible for the initial recruitment and maintenance of the kinetochore PLK1 population until its degradation. Involved in transcriptional repression (By similarity).By similarity

GO - Biological processi

  • chordate embryonic development Source: MGI

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-MMU-68877 Mitotic Prometaphase

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein U
Short name:
CENP-U
Alternative name(s):
MLF1-interacting protein
Gene namesi
Name:Cenpu
Synonyms:Mlf1ip
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1919126 Cenpu

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Kinetochore, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002476731 – 410Centromere protein UAdd BLAST410

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei74Phosphothreonine; by PLK1By similarity1
Modified residuei106PhosphoserineCombined sources1
Modified residuei111PhosphoserineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei131PhosphoserineBy similarity1
Modified residuei134PhosphoserineBy similarity1
Modified residuei136PhosphoserineBy similarity1
Modified residuei182PhosphoserineCombined sources1
Modified residuei186PhosphoserineCombined sources1
Modified residuei191PhosphothreonineCombined sources1
Modified residuei224PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by PLK1 at Thr-74, creating a self-tethering site that specifically interacts with the polo-box domain of PLK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8C4M7
PeptideAtlasiQ8C4M7
PRIDEiQ8C4M7

PTM databases

iPTMnetiQ8C4M7
PhosphoSitePlusiQ8C4M7

Expressioni

Tissue specificityi

Testis, spleen, heart, kidney, liver, lung, brain and CFU-E erythroid precursor cells.1 Publication

Developmental stagei

Expressed at different stages of development between embryonic days 7-17 (E7-E17) and highest expression seen at E11. Detected in the liver at E13.5 and strongly expressed in the cephalic mesenchyme and roof of the hindbrain, lining of the pericardial cavity and atrial chamber of the heart and lumen of the stomach in 11.5-day embryos.1 Publication

Gene expression databases

BgeeiENSMUSG00000031629 Expressed in 163 organ(s), highest expression level in camera-type eye
CleanExiMM_MLF1IP
ExpressionAtlasiQ8C4M7 baseline and differential
GenevisibleiQ8C4M7 MM

Interactioni

Subunit structurei

Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts with MLF1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi214999, 1 interactor
STRINGi10090.ENSMUSP00000034045

Structurei

3D structure databases

ProteinModelPortaliQ8C4M7
SMRiQ8C4M7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili291 – 352Sequence analysisAdd BLAST62

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi4 – 21Nuclear localization signalSequence analysisAdd BLAST18
Motifi295 – 312Nuclear localization signalSequence analysisAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi58 – 62Poly-Glu5

Sequence similaritiesi

Belongs to the CENP-U/AME1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J00R Eukaryota
ENOG410Z48V LUCA
GeneTreeiENSGT00390000015511
HOGENOMiHOG000236255
HOVERGENiHBG081090
InParanoidiQ8C4M7
KOiK11513
OMAiKQLHQDY
OrthoDBiEOG091G09Q1
PhylomeDBiQ8C4M7
TreeFamiTF330780

Family and domain databases

InterProiView protein in InterPro
IPR025214 CENP-U
PfamiView protein in Pfam
PF13097 CENP-U, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C4M7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAARRSLRYS GNPGAKHSKN TLRSTYSRKQ KAGPKPRPKD VFDFSNNSDA
60 70 80 90 100
SSIPGALEEE EETYETFDPP LHSTAIYAED ELSKHCVSSS SLATHRGKAS
110 120 130 140 150
RNLDPSEDEA SGNESIKVST KKPRRKLEPI SGESDSSADD VRRRVASAEG
160 170 180 190 200
PRSQQRQAAP AAPSPPERPA EPVTPRRTRL HSAQLSPVDE TPATQSQLKT
210 220 230 240 250
QKKVRPSPGR RKRPRRGHTD TDGSESMHIW CLEGKRQSDI TELDVILSVF
260 270 280 290 300
EKTFLEYKQR VESESCNQAI NKFYFKMKGE LIRMLKEAQM LKALKMKNTK
310 320 330 340 350
IIANMEKKRQ RLIEVQDELI RLEPQLKQLQ TKYDDLKERK SSLKKSKHFL
360 370 380 390 400
SNLKQLCQDY SNVQEKGPKG TGKYDSSSLP ALLFKARSIL GAENHLRTIN
410
YQLGKLLELD
Length:410
Mass (Da):46,370
Last modified:July 25, 2006 - v2
Checksum:iF2E8677FB373F75D
GO
Isoform 2 (identifier: Q8C4M7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-48: AKHSKNTLRSTYSRKQKAGPKPRPKDVFDFSNNS → PPSAQYGYLRRRRAVQTLCVLQFPGHPQREGEQK
     49-198: Missing.

Show »
Length:260
Mass (Da):30,268
Checksum:iB287F45F991A518A
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GS54A0A1B0GS54_MOUSE
Centromere protein U
Cenpu
51Annotation score:
A0A1B0GS45A0A1B0GS45_MOUSE
Centromere protein U
Cenpu
113Annotation score:
D6RJ34D6RJ34_MOUSE
Centromere protein U
Cenpu
43Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti327K → E in BAC38300 (PubMed:15116101).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02003115 – 48AKHSK…FSNNS → PPSAQYGYLRRRRAVQTLCV LQFPGHPQREGEQK in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_02003249 – 198Missing in isoform 2. 1 PublicationAdd BLAST150

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY366362 mRNA Translation: AAR13082.1
AK006479 mRNA Translation: BAB24609.1
AK050386 mRNA Translation: BAC34227.1
AK081703 mRNA Translation: BAC38300.1
CCDSiCCDS22292.1 [Q8C4M7-1]
RefSeqiNP_082249.1, NM_027973.3 [Q8C4M7-1]
UniGeneiMm.217385
Mm.22108

Genome annotation databases

EnsembliENSMUST00000034045; ENSMUSP00000034045; ENSMUSG00000031629 [Q8C4M7-1]
ENSMUST00000093518; ENSMUSP00000091239; ENSMUSG00000031629 [Q8C4M7-2]
GeneIDi71876
KEGGimmu:71876
UCSCiuc009lqg.1 mouse [Q8C4M7-1]
uc009lqh.1 mouse [Q8C4M7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY366362 mRNA Translation: AAR13082.1
AK006479 mRNA Translation: BAB24609.1
AK050386 mRNA Translation: BAC34227.1
AK081703 mRNA Translation: BAC38300.1
CCDSiCCDS22292.1 [Q8C4M7-1]
RefSeqiNP_082249.1, NM_027973.3 [Q8C4M7-1]
UniGeneiMm.217385
Mm.22108

3D structure databases

ProteinModelPortaliQ8C4M7
SMRiQ8C4M7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi214999, 1 interactor
STRINGi10090.ENSMUSP00000034045

PTM databases

iPTMnetiQ8C4M7
PhosphoSitePlusiQ8C4M7

Proteomic databases

PaxDbiQ8C4M7
PeptideAtlasiQ8C4M7
PRIDEiQ8C4M7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034045; ENSMUSP00000034045; ENSMUSG00000031629 [Q8C4M7-1]
ENSMUST00000093518; ENSMUSP00000091239; ENSMUSG00000031629 [Q8C4M7-2]
GeneIDi71876
KEGGimmu:71876
UCSCiuc009lqg.1 mouse [Q8C4M7-1]
uc009lqh.1 mouse [Q8C4M7-2]

Organism-specific databases

CTDi79682
MGIiMGI:1919126 Cenpu

Phylogenomic databases

eggNOGiENOG410J00R Eukaryota
ENOG410Z48V LUCA
GeneTreeiENSGT00390000015511
HOGENOMiHOG000236255
HOVERGENiHBG081090
InParanoidiQ8C4M7
KOiK11513
OMAiKQLHQDY
OrthoDBiEOG091G09Q1
PhylomeDBiQ8C4M7
TreeFamiTF330780

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-MMU-68877 Mitotic Prometaphase

Miscellaneous databases

ChiTaRSiCenpu mouse
PROiPR:Q8C4M7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031629 Expressed in 163 organ(s), highest expression level in camera-type eye
CleanExiMM_MLF1IP
ExpressionAtlasiQ8C4M7 baseline and differential
GenevisibleiQ8C4M7 MM

Family and domain databases

InterProiView protein in InterPro
IPR025214 CENP-U
PfamiView protein in Pfam
PF13097 CENP-U, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCENPU_MOUSE
AccessioniPrimary (citable) accession number: Q8C4M7
Secondary accession number(s): Q6UNA2, Q9D9U1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: July 25, 2006
Last modified: November 7, 2018
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again