Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein RFT1 homolog

Gene

Rft1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May be involved in N-linked oligosaccharide assembly. May participate in the translocation of oligosaccharide from the cytoplasmic side to the lumenal side of the endoplasmic reticulum membrane (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • carbohydrate transport Source: UniProtKB-KW
  • glycolipid translocation Source: GO_Central

Keywordsi

Biological processSugar transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Protein RFT1 homolog
Gene namesi
Name:Rft1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:3607791 Rft1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei16 – 36HelicalSequence analysisAdd BLAST21
Transmembranei45 – 62HelicalSequence analysisAdd BLAST18
Transmembranei85 – 105HelicalSequence analysisAdd BLAST21
Transmembranei123 – 143HelicalSequence analysisAdd BLAST21
Transmembranei154 – 176HelicalSequence analysisAdd BLAST23
Transmembranei187 – 207HelicalSequence analysisAdd BLAST21
Transmembranei335 – 355HelicalSequence analysisAdd BLAST21
Transmembranei376 – 396HelicalSequence analysisAdd BLAST21
Transmembranei414 – 434HelicalSequence analysisAdd BLAST21
Transmembranei470 – 490HelicalSequence analysisAdd BLAST21
Transmembranei499 – 519HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003112871 – 541Protein RFT1 homologAdd BLAST541

Proteomic databases

PaxDbiQ8C3B8
PRIDEiQ8C3B8

PTM databases

iPTMnetiQ8C3B8
PhosphoSitePlusiQ8C3B8

Expressioni

Gene expression databases

BgeeiENSMUSG00000052395 Expressed in 20 organ(s), highest expression level in liver
CleanExiMM_RFT1

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000064153

Structurei

3D structure databases

ProteinModelPortaliQ8C3B8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the RFT1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2864 Eukaryota
ENOG410Y1D5 LUCA
GeneTreeiENSGT00390000011390
HOGENOMiHOG000007364
HOVERGENiHBG106670
InParanoidiQ8C3B8
KOiK06316
OMAiWPGKLFG
OrthoDBiEOG091G0D5P
PhylomeDBiQ8C3B8
TreeFamiTF313129

Family and domain databases

InterProiView protein in InterPro
IPR007594 RFT1
PANTHERiPTHR13117 PTHR13117, 1 hit
PfamiView protein in Pfam
PF04506 Rft-1, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C3B8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSQEVLGQA ARLASSGLLL QVLFRLITFV LNAFILRFLS KEIVGIVNVR
60 70 80 90 100
LTLLYSTTTF LAREAFRRAC LSGGAQRDWS QTLNLLWLTV PLGIFWSSCL
110 120 130 140 150
GWVWLQLLEV PDPDVVPYYG TGVLFFGLSA VVELLGEPFW VLAQAHMFVK
160 170 180 190 200
LKVLAESMSV ILRSVLTALL VLWLPHWGLY IFSLAQLLYT TVLVLCYAIY
210 220 230 240 250
LIQLLRSPES AKQLTLPVSR VTQLLPSISR SRAFVNWKEA GLAWSFFKQS
260 270 280 290 300
FLKQILTEGE RYVMTFLNVL NFGDQGVYDI VNNLGSLVAR LIFQPVEESF
310 320 330 340 350
YLFFAKVLER EKDASLQKQD DVAVAAAVLE SLLKLALLTG LTMTVFGFAY
360 370 380 390 400
SQLALDIYGG AMLSSGSGPV LMRCYCLYVL LLAINGVTEC FMFAAMSKEE
410 420 430 440 450
VDRYNFTMLA LSSSFLVLSY LLTSWCGSVG FIMANCFNMG IRITQSLSFI
460 470 480 490 500
HHYFRESPHR PLAGLRLSPV LLGVFILSAG ITSVSEAFLC CERGWPARLA
510 520 530 540
HIAVGTICLG VTLGTAFLTE TKLIHFLRTQ LGRSRLSDKM T
Length:541
Mass (Da):60,303
Last modified:November 13, 2007 - v2
Checksum:iEAD30B02F74CF279
GO
Isoform 2 (identifier: Q8C3B8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-220: LLYTTVLVLCYAIYLIQLLRSPESAKQLTLPVSR → VRVVALLFTRLSSLLVPTSMCLCSQYSCCGIVGN
     221-541: Missing.

Show »
Length:220
Mass (Da):24,460
Checksum:iBEF3CCF70AE420B1
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2I3BRR4A0A2I3BRR4_MOUSE
Protein RFT1 homolog
Rft1
280Annotation score:
A0A2I3BQF5A0A2I3BQF5_MOUSE
Protein RFT1 homolog
Rft1
380Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_029509187 – 220LLYTT…LPVSR → VRVVALLFTRLSSLLVPTSM CLCSQYSCCGIVGN in isoform 2. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_029510221 – 541Missing in isoform 2. 2 PublicationsAdd BLAST321

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK086390 mRNA Translation: BAC39658.1
AC154436 Genomic DNA No translation available.
AC154646 Genomic DNA No translation available.
BC116368 mRNA Translation: AAI16369.1
BC116369 mRNA Translation: AAI16370.1
BC141275 mRNA Translation: AAI41276.1
CCDSiCCDS26896.1 [Q8C3B8-1]
RefSeqiNP_808483.2, NM_177815.3 [Q8C3B8-1]
UniGeneiMm.259657

Genome annotation databases

EnsembliENSMUST00000064230; ENSMUSP00000064153; ENSMUSG00000052395 [Q8C3B8-1]
GeneIDi328370
KEGGimmu:328370
UCSCiuc007svm.1 mouse [Q8C3B8-2]
uc007svn.1 mouse [Q8C3B8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK086390 mRNA Translation: BAC39658.1
AC154436 Genomic DNA No translation available.
AC154646 Genomic DNA No translation available.
BC116368 mRNA Translation: AAI16369.1
BC116369 mRNA Translation: AAI16370.1
BC141275 mRNA Translation: AAI41276.1
CCDSiCCDS26896.1 [Q8C3B8-1]
RefSeqiNP_808483.2, NM_177815.3 [Q8C3B8-1]
UniGeneiMm.259657

3D structure databases

ProteinModelPortaliQ8C3B8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000064153

PTM databases

iPTMnetiQ8C3B8
PhosphoSitePlusiQ8C3B8

Proteomic databases

PaxDbiQ8C3B8
PRIDEiQ8C3B8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000064230; ENSMUSP00000064153; ENSMUSG00000052395 [Q8C3B8-1]
GeneIDi328370
KEGGimmu:328370
UCSCiuc007svm.1 mouse [Q8C3B8-2]
uc007svn.1 mouse [Q8C3B8-1]

Organism-specific databases

CTDi91869
MGIiMGI:3607791 Rft1

Phylogenomic databases

eggNOGiKOG2864 Eukaryota
ENOG410Y1D5 LUCA
GeneTreeiENSGT00390000011390
HOGENOMiHOG000007364
HOVERGENiHBG106670
InParanoidiQ8C3B8
KOiK06316
OMAiWPGKLFG
OrthoDBiEOG091G0D5P
PhylomeDBiQ8C3B8
TreeFamiTF313129

Miscellaneous databases

PROiPR:Q8C3B8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000052395 Expressed in 20 organ(s), highest expression level in liver
CleanExiMM_RFT1

Family and domain databases

InterProiView protein in InterPro
IPR007594 RFT1
PANTHERiPTHR13117 PTHR13117, 1 hit
PfamiView protein in Pfam
PF04506 Rft-1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRFT1_MOUSE
AccessioniPrimary (citable) accession number: Q8C3B8
Secondary accession number(s): B2RUN9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: November 7, 2018
This is version 101 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again