Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Roundabout homolog 4

Gene

Robo4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for Slit proteins, at least for SLIT2, and seems to be involved in angiogenesis and vascular patterning. May mediate the inhibition of primary endothelial cell migration by Slit proteins.1 Publication

GO - Molecular functioni

  • signaling receptor activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, Receptor
Biological processAngiogenesis, Differentiation

Names & Taxonomyi

Protein namesi
Recommended name:
Roundabout homolog 4
Gene namesi
Name:Robo4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1921394 Robo4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 27Sequence analysisAdd BLAST27
ChainiPRO_000003104128 – 1012Roundabout homolog 4Add BLAST985

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi53 ↔ 115PROSITE-ProRule annotation
Disulfide bondi159 ↔ 208PROSITE-ProRule annotation
Glycosylationi201N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi247N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi361N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi390N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi397N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi681N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi713N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi762N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi783N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei814PhosphoserineBy similarity1
Modified residuei947PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8C310
PRIDEiQ8C310

PTM databases

iPTMnetiQ8C310
PhosphoSitePlusiQ8C310

Expressioni

Tissue specificityi

Expressed specifically in embryo and adult vascular endothelium.1 Publication

Developmental stagei

In embryonic development of vascular endothelium shows a dynamic expression pattern within vessels, with expression starting in the larger axial vessels and intersomitic vessels at earlier ages, and changing to intersomitic vessel and capillary expression at later stages. At E9.0, is expressed in the central vessels, the dorsal aorta, and intersomitic vessels. At E9.5, is highly expressed in intersomitic vessels with little expression remaining in dorsal aortae. By E10.0, is detected in capillary vessels, the capillary plexus of the limb buds, and throughout the endothelium as microvessels sprout from the dorsal aortae. No expression was detected in the neural tube at E9.0 and E9.5. However, it is detected within the capillaries sprouting into the neural tube, as well as in the adjacent perineural capillary plexus at E10.0.1 Publication

Gene expression databases

CleanExiMM_ROBO4

Interactioni

Subunit structurei

Interacts with SLIT2 and ENAH.1 Publication

Protein-protein interaction databases

BioGridi216523, 1 interactor
STRINGi10090.ENSMUSP00000099959

Structurei

3D structure databases

ProteinModelPortaliQ8C310
SMRiQ8C310
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 132Ig-like C2-type 1Add BLAST101
Domaini138 – 225Ig-like C2-type 2Add BLAST88
Domaini249 – 346Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST98
Domaini348 – 443Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ROBO family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410INZ5 Eukaryota
ENOG410YX7X LUCA
HOGENOMiHOG000074193
HOVERGENiHBG061836
InParanoidiQ8C310
KOiK06784
PhylomeDBiQ8C310
TreeFamiTF351053

Family and domain databases

CDDicd00063 FN3, 1 hit
Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF07679 I-set, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
SSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C310-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSGGTGLLG TEWPLPLLLL FIMGGEALDS PPQILVHPQD QLLQGSGPAK
60 70 80 90 100
MRCRSSGQPP PTIRWLLNGQ PLSMATPDLH YLLPDGTLLL HRPSVQGRPQ
110 120 130 140 150
DDQNILSAIL GVYTCEASNR LGTAVSRGAR LSVAVLQEDF QIQPRDTVAV
160 170 180 190 200
VGESLVLECG PPWGYPKPSV SWWKDGKPLV LQPGRRTVSG DSLMVSRAEK
210 220 230 240 250
NDSGTYMCMA TNNAGQRESR AARVSIQESQ DHKEHLELLA VRIQLENVTL
260 270 280 290 300
LNPEPVKGPK PGPSVWLSWK VSGPAAPAES YTALFRTQRS PRDQGSPWTE
310 320 330 340 350
VLLRGLQSAK LGGLHWGQDY EFKVRPSSGR ARGPDSNVLL LRLPEQVPSA
360 370 380 390 400
PPQGVTLRSG NGSVFVSWAP PPAESHNGVI RGYQVWSLGN ASLPAANWTV
410 420 430 440 450
VGEQTQLEIA TRLPGSYCVQ VAAVTGAGAG ELSTPVCLLL EQAMEQSARD
460 470 480 490 500
PRKHVPWTLE QLRATLRRPE VIASSAVLLW LLLLGITVCI YRRRKAGVHL
510 520 530 540 550
GPGLYRYTSE DAILKHRMDH SDSPWLADTW RSTSGSRDLS SSSSLSSRLG
560 570 580 590 600
LDPRDPLEGR RSLISWDPRS PGVPLLPDTS TFYGSLIAEQ PSSPPVRPSP
610 620 630 640 650
KTPAARRFPS KLAGTSSPWA SSDSLCSRRG LCSPRMSLTP TEAWKAKKKQ
660 670 680 690 700
ELHQANSSPL LRGSHPMEIW AWELGSRASK NLSQSPGPNS GSPGEAPRAV
710 720 730 740 750
VSWRAVGPQL HRNSSELASR PLPPTPLSLR GASSHDPQSQ CVEKLQAPSS
760 770 780 790 800
DPLPAAPLSV LNSSRPSSPQ ASFLSCPSPS SSNLSSSSLS SLEEEEDQDS
810 820 830 840 850
VLTPEEVALC LELSDGEETP TNSVSPMPRA PSPPTTYGYI SIPTCSGLAD
860 870 880 890 900
MGRAGGGVGS EVGNLLYPPR PCPTPTPSEG SLANGWGSAS EDNVPSARAS
910 920 930 940 950
LVSSSDGSFL ADTHFARALA VAVDSFGLSL DPREADCVFT DASSPPSPRG
960 970 980 990 1000
DLSLTRSFSL PLWEWRPDWL EDAEISHTQR LGRGLPPWPP DSRASSQRSW
1010
LTGAVPKAGD SS
Length:1,012
Mass (Da):108,499
Last modified:June 21, 2004 - v2
Checksum:i9116352CAE767CC1
GO
Isoform 2 (identifier: Q8C310-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     688-694: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,005
Mass (Da):107,903
Checksum:i95F8C43EE184E21E
GO
Isoform 3 (identifier: Q8C310-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-440: L → LGEGKALSISSTPPPCRPSVSQFLSYIFSSSLSCLLVPLTVPLALPLSSTSQT
     688-694: Missing.

Show »
Length:1,057
Mass (Da):113,251
Checksum:iBDC167380727CBF7
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1SUF8A0A1L1SUF8_MOUSE
Roundabout homolog 4
Robo4
1,022Annotation score:
D3Z4M4D3Z4M4_MOUSE
Roundabout homolog 4
Robo4
1,074Annotation score:
A0A0R4J197A0A0R4J197_MOUSE
Roundabout homolog 4
Robo4
1,015Annotation score:
E9QN68E9QN68_MOUSE
Roundabout homolog 4
Robo4
911Annotation score:
A0A1L1SSV2A0A1L1SSV2_MOUSE
Roundabout homolog 4
Robo4
318Annotation score:

Sequence cautioni

The sequence AAH20129 differs from that shown. Reason: Erroneous initiation.Curated
Isoform 2 : The sequence AAH20129 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB23506 differs from that shown. Reason: Erroneous initiation.Curated
Isoform 2 : The sequence BAB23506 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
Isoform 3 : The sequence BAC39850 differs from that shown. Reason: Frameshift at positions 916 and 919.Curated
Isoform 3 : The sequence BAC39850 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010663440L → LGEGKALSISSTPPPCRPSV SQFLSYIFSSSLSCLLVPLT VPLALPLSSTSQT in isoform 3. 1 Publication1
Alternative sequenceiVSP_010662688 – 694Missing in isoform 2 and isoform 3. 2 Publications7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF536772 mRNA Translation: AAQ10749.1
AK004723 mRNA Translation: BAB23506.2 Different initiation.
AK087355 mRNA Translation: BAC39850.1 Sequence problems.
BC020129 mRNA Translation: AAH20129.1 Different initiation.
RefSeqiNP_001296319.1, NM_001309390.1
NP_083059.2, NM_028783.3
UniGeneiMm.485070

Genome annotation databases

GeneIDi74144
KEGGimmu:74144
UCSCiuc009ous.1 mouse [Q8C310-2]
uc012gqy.1 mouse [Q8C310-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF536772 mRNA Translation: AAQ10749.1
AK004723 mRNA Translation: BAB23506.2 Different initiation.
AK087355 mRNA Translation: BAC39850.1 Sequence problems.
BC020129 mRNA Translation: AAH20129.1 Different initiation.
RefSeqiNP_001296319.1, NM_001309390.1
NP_083059.2, NM_028783.3
UniGeneiMm.485070

3D structure databases

ProteinModelPortaliQ8C310
SMRiQ8C310
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi216523, 1 interactor
STRINGi10090.ENSMUSP00000099959

PTM databases

iPTMnetiQ8C310
PhosphoSitePlusiQ8C310

Proteomic databases

PaxDbiQ8C310
PRIDEiQ8C310

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi74144
KEGGimmu:74144
UCSCiuc009ous.1 mouse [Q8C310-2]
uc012gqy.1 mouse [Q8C310-1]

Organism-specific databases

CTDi54538
MGIiMGI:1921394 Robo4

Phylogenomic databases

eggNOGiENOG410INZ5 Eukaryota
ENOG410YX7X LUCA
HOGENOMiHOG000074193
HOVERGENiHBG061836
InParanoidiQ8C310
KOiK06784
PhylomeDBiQ8C310
TreeFamiTF351053

Miscellaneous databases

PROiPR:Q8C310
SOURCEiSearch...

Gene expression databases

CleanExiMM_ROBO4

Family and domain databases

CDDicd00063 FN3, 1 hit
Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF07679 I-set, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
SSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiROBO4_MOUSE
AccessioniPrimary (citable) accession number: Q8C310
Secondary accession number(s): Q9DBW1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: November 7, 2018
This is version 133 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again