Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein Eos

Gene

Ikzf4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

DNA-binding protein that binds to the 5'GGGAATRCC-3' Ikaros-binding sequence. Interacts with SPI1 and MITF to repress transcription of the CTSK and ACP5 promoters via recruitment of corepressors SIN3A and CTBP2. May be involved in the development of central and peripheral nervous systems. Essential for the inhibitory function of regulatory T-cells (Treg). Mediates FOXP3-mediated gene silencing in regulatory T-cells (Treg) via recruitment of corepressor CTBP1 (PubMed:19696312).3 Publications

Miscellaneous

Eos is a Greek word for rising sun.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri159 – 181C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri187 – 209C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri215 – 237C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri248 – 271C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri531 – 553C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri559 – 583C2H2-type 6PROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein Eos
Alternative name(s):
Ikaros family zinc finger protein 4
Gene namesi
Name:Ikzf4
Synonyms:Zfpn1a4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1343139 Ikzf4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002994691 – 586Zinc finger protein EosAdd BLAST586

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki100Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei105PhosphoserineBy similarity1
Modified residuei335N6-acetyllysineBy similarity1
Cross-linki501Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ8C208
PRIDEiQ8C208

PTM databases

iPTMnetiQ8C208
PhosphoSitePlusiQ8C208

Expressioni

Tissue specificityi

Expressed mainly in the brain. Up-regulated in long term cultured astrocytes. Down-regulated during osteoclast differentiation.2 Publications

Developmental stagei

Highly expressed in the brain at E15 and E18. Expression gradually decreased as postnatal development proceeded. No expression detected in the liver, kidney, lung, thymus or spleen during all developmental stages.1 Publication

Gene expression databases

BgeeiENSMUSG00000002578 Expressed in 212 organ(s), highest expression level in secondary oocyte
CleanExiMM_IKZF4
ExpressionAtlasiQ8C208 baseline and differential
GenevisibleiQ8C208 MM

Interactioni

Subunit structurei

Self-associates. Interacts with other family members; IKZF1, IKZF2, IKZF3 AND IKZF5 (By similarity). Interacts with CTBP2, SPI1 and MITF. Interacts with FOXP3 and CTBP1.By similarity4 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204703, 1 interactor
STRINGi10090.ENSMUSP00000114404

Structurei

3D structure databases

ProteinModelPortaliQ8C208
SMRiQ8C208
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni281 – 586Interaction with FOXP31 PublicationAdd BLAST306

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi423 – 433CTBP-binding motif PEDLGAdd BLAST11

Domaini

The N-terminal zinc fingers are involved in sequence-specific DNA binding.
C-terminal zinc fingers mediate homodimerization.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri159 – 181C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri187 – 209C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri215 – 237C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri248 – 271C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri531 – 553C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri559 – 583C2H2-type 6PROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00550000074392
HOGENOMiHOG000049114
HOVERGENiHBG004752
InParanoidiQ8C208
KOiK09220
OrthoDBiEOG091G05E2
PhylomeDBiQ8C208
TreeFamiTF331189

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 6 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C208-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHTPPALPRR FQGGGRVRTP GSHRQGKDNL ERELSGGCAP DFLPQAQDSN
60 70 80 90 100
HFIMESLFCE SSGDSSLEKE FLGAPVGPSV STPNSQHSSP SRSLSANSIK
110 120 130 140 150
VEMYSDEESS RLLGPDERLL DKDDSVIVED SLSEPLGYCD GSGPEPHSPG
160 170 180 190 200
GIRLPNGKLK CDVCGMVCIG PNVLMVHKRS HTGERPFHCN QCGASFTQKG
210 220 230 240 250
NLLRHIKLHS GEKPFKCPFC NYACRRRDAL TGHLRTHSVS SPTVGKPYKC
260 270 280 290 300
NYCGRSYKQQ STLEEHKERC HNYLQSLSTD AQALTGQPGD EIRDLEMVPD
310 320 330 340 350
SMLHPSTERP TFIDRLANSL TKRKRSTPQK FVGEKQMRFS LSDLPYDVNA
360 370 380 390 400
SGGYEKDVEL VAHHGLEPGF GGSLAFVGTE HLRPLRLPPT NCISELTPVI
410 420 430 440 450
SSVYTQMQPI PSRLELPGSR EAGEGPEDLG DGGPLLYRAR GSLTDPGASP
460 470 480 490 500
SNGCQDSTDT ESNHEDRIGG VVSLPQGPPP QPPPTIVVGR HSPAYAKEDP
510 520 530 540 550
KPQEGLLRGT PGPSKEVLRV VGESGEPVKA FKCEHCRILF LDHVMFTIHM
560 570 580
GCHGFRDPFE CNICGYHSQD RYEFSSHIVR GEHKVG
Length:586
Mass (Da):64,155
Last modified:September 11, 2007 - v2
Checksum:iBC39FF5BBE7F914C
GO
Isoform 2 (identifier: Q8C208-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.

Show »
Length:533
Mass (Da):58,335
Checksum:iBDFCCC00C23C5746
GO
Isoform 3 (identifier: Q8C208-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERELSGGCAPDFLPQAQDSNHFIMESLFCES → MFIPVG

Note: No experimental confirmation available.
Show »
Length:531
Mass (Da):58,052
Checksum:i7DA51FC4203BC451
GO
Isoform 4 (identifier: Q8C208-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     572-586: YEFSSHIVRGEHKVG → TRRLVPRLLG...SSIAGGSLSL

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):75,075
Checksum:iAAF4318A96EA1307
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1Y7VK04A0A1Y7VK04_MOUSE
Zinc finger protein Eos
Ikzf4 Zfpn1a4, mCG_130566
71Annotation score:
A0A1Y7VK30A0A1Y7VK30_MOUSE
Zinc finger protein Eos
Ikzf4
45Annotation score:

Sequence cautioni

The sequence BAA36213 differs from that shown. Reason: Frameshift at positions 472 and 479.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti70 – 71EF → DS in BAA36213 (PubMed:10218586).Curated2
Sequence conflicti291E → V in BAE41808 (PubMed:16141072).Curated1
Sequence conflicti352G → S in BAE41808 (PubMed:16141072).Curated1
Sequence conflicti478P → T in BAC40912 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0276891 – 61MHTPP…LFCES → MFIPVG in isoform 3. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0276901 – 53Missing in isoform 2. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_027691572 – 586YEFSS…EHKVG → TRRLVPRLLGPVMINGREKG DVSFLSANFQYNQKNCPRMN YTYVPVNHSTLVPARMGRTQ LGVTSTALSILSSRHRAGEA VFSGGCRHSGYSDNRGFVRP CRRRHSSIAGGSLSL in isoform 4. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017615 mRNA Translation: BAA36213.1 Frameshift.
AK089522 mRNA Translation: BAC40912.1
AK170453 mRNA Translation: BAE41808.1
AC117232 Genomic DNA No translation available.
BC141286 mRNA Translation: AAI41287.1
CCDSiCCDS24284.2 [Q8C208-1]
RefSeqiNP_035902.2, NM_011772.2 [Q8C208-1]
XP_006513677.1, XM_006513614.2
XP_006513678.1, XM_006513615.2
XP_011241744.1, XM_011243442.2 [Q8C208-2]
UniGeneiMm.358648

Genome annotation databases

EnsembliENSMUST00000133342; ENSMUSP00000114404; ENSMUSG00000002578 [Q8C208-1]
ENSMUST00000221150; ENSMUSP00000152617; ENSMUSG00000002578 [Q8C208-4]
ENSMUST00000222067; ENSMUSP00000152234; ENSMUSG00000002578 [Q8C208-2]
GeneIDi22781
KEGGimmu:22781
UCSCiuc007hnp.1 mouse [Q8C208-1]
uc011xqg.1 mouse [Q8C208-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017615 mRNA Translation: BAA36213.1 Frameshift.
AK089522 mRNA Translation: BAC40912.1
AK170453 mRNA Translation: BAE41808.1
AC117232 Genomic DNA No translation available.
BC141286 mRNA Translation: AAI41287.1
CCDSiCCDS24284.2 [Q8C208-1]
RefSeqiNP_035902.2, NM_011772.2 [Q8C208-1]
XP_006513677.1, XM_006513614.2
XP_006513678.1, XM_006513615.2
XP_011241744.1, XM_011243442.2 [Q8C208-2]
UniGeneiMm.358648

3D structure databases

ProteinModelPortaliQ8C208
SMRiQ8C208
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204703, 1 interactor
STRINGi10090.ENSMUSP00000114404

PTM databases

iPTMnetiQ8C208
PhosphoSitePlusiQ8C208

Proteomic databases

PaxDbiQ8C208
PRIDEiQ8C208

Protocols and materials databases

DNASUi22781
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000133342; ENSMUSP00000114404; ENSMUSG00000002578 [Q8C208-1]
ENSMUST00000221150; ENSMUSP00000152617; ENSMUSG00000002578 [Q8C208-4]
ENSMUST00000222067; ENSMUSP00000152234; ENSMUSG00000002578 [Q8C208-2]
GeneIDi22781
KEGGimmu:22781
UCSCiuc007hnp.1 mouse [Q8C208-1]
uc011xqg.1 mouse [Q8C208-3]

Organism-specific databases

CTDi64375
MGIiMGI:1343139 Ikzf4

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00550000074392
HOGENOMiHOG000049114
HOVERGENiHBG004752
InParanoidiQ8C208
KOiK09220
OrthoDBiEOG091G05E2
PhylomeDBiQ8C208
TreeFamiTF331189

Miscellaneous databases

ChiTaRSiIkzf4 mouse
PROiPR:Q8C208
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000002578 Expressed in 212 organ(s), highest expression level in secondary oocyte
CleanExiMM_IKZF4
ExpressionAtlasiQ8C208 baseline and differential
GenevisibleiQ8C208 MM

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 6 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiIKZF4_MOUSE
AccessioniPrimary (citable) accession number: Q8C208
Secondary accession number(s): B9EJ21, Q3TCZ7, Q9Z2Z2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: November 7, 2018
This is version 138 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again