Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dedicator of cytokinesis protein 10

Gene

Dock10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide-exchange factor (GEF) that activates CDC42 and RAC1 by exchanging bound GDP for free GTP. Essential for dendritic spine morphogenesis in Purkinje cells and in hippocampal neurons, via a CDC42-mediated pathway (PubMed:25851601). Sustains B-cell lymphopoiesis in secondary lymphoid tissues and regulates FCER2/CD23 expression (PubMed:27502165).2 Publications

Miscellaneous

'Zizim' means 'spike' in Hebrew.Curated

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: UniProtKB
  • Rho GTPase binding Source: MGI
  • Rho guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Dedicator of cytokinesis protein 10Curated
Alternative name(s):
Zizimin-3
Gene namesi
Name:Dock10Imported
Synonyms:Kiaa0694, Ziz3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2146320 Dock10

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Knockout mice are viable and fertile (PubMed:25729399, PubMed:27502165). They show decreased numbers of B-cells in spleen, both follicular B-cells and marginal zone B-cells, and in peripheral blood, but not in bone marrow (PubMed:25729399, PubMed:27502165). Their percentage of splenic CD8+ T-cells is decreased comparing to wild types (PubMed:25729399).2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001900031 – 2150Dedicator of cytokinesis protein 10Add BLAST2150

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei196PhosphothreonineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei368PhosphothreonineCombined sources1
Modified residuei834N6-acetyllysineBy similarity1
Modified residuei877PhosphoserineCombined sources1
Modified residuei1232PhosphoserineBy similarity1
Modified residuei1251PhosphoserineCombined sources1
Modified residuei1257PhosphoserineCombined sources1
Modified residuei1292PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1318PhosphoserineCombined sources1
Modified residuei1406PhosphothreonineCombined sources1
Modified residuei1440PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8BZN6
PaxDbiQ8BZN6
PeptideAtlasiQ8BZN6
PRIDEiQ8BZN6

PTM databases

iPTMnetiQ8BZN6
PhosphoSitePlusiQ8BZN6

Expressioni

Tissue specificityi

Expressed in brain, lung, spleen, mesenteric lymph nodes (MLN) and thymus (PubMed:15710388, PubMed:25729399). Expressed by B and T splenocytes (PubMed:21514340). In brain, expressed by Purkinje cells during postnatal development and hippocampal neurons (PubMed:25851601).4 Publications

Developmental stagei

At early postnatal stages, expressed broadly in the cerebellum and from P15 the expression becomes restricted to Purkinje cells.1 Publication

Inductioni

Isoform 4 (but not isoform 1) is highly induced by IL4 in B splenocytes, but not T splenocytes.1 Publication

Gene expression databases

CleanExiMM_DOCK10

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi229145, 2 interactors
IntActiQ8BZN6, 1 interactor
STRINGi10090.ENSMUSP00000077099

Structurei

3D structure databases

ProteinModelPortaliQ8BZN6
SMRiQ8BZN6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini181 – 290PHPROSITE-ProRule annotationAdd BLAST110
Domaini672 – 850DHR-1PROSITE-ProRule annotationAdd BLAST179
Domaini1690 – 2150DHR-2PROSITE-ProRule annotationAdd BLAST461

Domaini

The DHR-2 domain may mediate some GEF activity.1 Publication

Sequence similaritiesi

Belongs to the DOCK family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
HOGENOMiHOG000231373
HOVERGENiHBG107819
InParanoidiQ8BZN6
KOiK21853
PhylomeDBiQ8BZN6

Family and domain databases

CDDicd08697 C2_Dock-D, 1 hit
Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR23317 PTHR23317, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BZN6-1) [UniParc]FASTAAdd to basket
Also known as: DOCK10.11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGERTRRFT RSLLRPGQAA ELRHSAASAA AVAVSSRQQQ RQEKPRLLDP
60 70 80 90 100
LDYETVIEEL EKTYRDDPLQ DLLFFPSDDF STATVSWDIR TLYSTVPEEA
110 120 130 140 150
EHRAESLLVK EACKFYSSQW YVVNYKYEQY SGDIRQLPRA EHKPEKLPSH
160 170 180 190 200
SFEVDHEDAD KDEDTTSHSS SKGGGGAGGT GVFKSGWLYK GNFNSTVNNT
210 220 230 240 250
VTVRSFKKRY FQLTQLPDNS YIMNFYKDEK ISKEPKGCIF LDSCTGVVQN
260 270 280 290 300
NRLRKYAFEL KMNDLTYFVL AAETESDMDE WIHTLNRILQ ISPEGPLQGR
310 320 330 340 350
KSAELAELGL DPLDNCVTCE CTLEETDSSE NSLHPDFAKY LTETEDTVKT
360 370 380 390 400
TRNMGRLNLF SLDPDIDTLK LQKRDSFENE LMIKPFEEKA AKRIMIICRA
410 420 430 440 450
LNFNLQGCVT ENEYDPVTNI EPFFVSVALY DLRDNRKISA DFHVDLNHPA
460 470 480 490 500
VRQMLSGTPP ALENGNIDTG TPRQSEEPHI KGLPEEWLKF PKQAVFSVSD
510 520 530 540 550
PHSEIVLVAK VEKVLMGNIG SGAEPYIKNP DSNKFAQKIL KSNRQFCSKL
560 570 580 590 600
GKYRMPFAWA VRSVFKDNQG NVDRDSRFSP LYRQESSKMS SEDLLKLVSD
610 620 630 640 650
YRRADRISKM QSIPGSLDIA VDNIPLEHPN CVTSSFIPVK PFNVSAQSEP
660 670 680 690 700
TVEVEEFIYD STKYCRPYRV YKNQIYVYPK HLKYDSQKCF NKARNITVCI
710 720 730 740 750
EFKNSDDDGA KPMKCIYGKP GGPLFTSSAY TAVLHHSQNP DFSDEVKIEL
760 770 780 790 800
PTQLHGKHHL LFSFYHITCD INAKANAKKK EALETSVGYA WLPLMKHDQI
810 820 830 840 850
ASQEYNIPIA TTLPPNYLSI QDPTSAKHGG SDIKWVDGGK PLFKVSTFVV
860 870 880 890 900
STVNTQDPHV NAFFRQCQKR EKDMSQSPTS SFVRACKNLL NVDKIHSIMS
910 920 930 940 950
FLPIILNQLF KILVQNEEDE ITATVTRVLA DIVAKCHEEQ LDHSVQSYIK
960 970 980 990 1000
FVFKTKSYKE RTIHEELAKN LSDLLKSNDS TIVKHVLEHS WFFFAIILKS
1010 1020 1030 1040 1050
MAQHLIDTNK IQLPRAQRFP ESYQSELDNL VMGLCDHVIW KCKEAPEETK
1060 1070 1080 1090 1100
RANHSVARFL KRCFTFMDRG FVFKMVNNYI SMFSSGEFKT LCQYKFDFLQ
1110 1120 1130 1140 1150
EVCQHEHFIP LCLPIRSANI PDPLTPSESI RELHASDMPE YSVTNEFCRK
1160 1170 1180 1190 1200
HFLIGILLRE VGFALQEDQD IRHLALAVLK NLMAKHSFDD RYREPRKQAQ
1210 1220 1230 1240 1250
IASLYMPLYG MLLDNMPRIY LKDLYPFTVN TSNQGSRDDL STNGGFQTQT
1260 1270 1280 1290 1300
SMKHATSVDT SFSKDVLNSI AAFSSIAIST VNHADSRASL ASLDSNPSTT
1310 1320 1330 1340 1350
EKSSEKTDNC EKIPRPLSLI GSTLRFDKLD QAETRSLLMC FLHIMKTISD
1360 1370 1380 1390 1400
ETLIAYWQRA PSPEVSDFFS ILDVCLQNFR YLGKRNIIRK IAAAFKFVQS
1410 1420 1430 1440 1450
TQNNGTLKGS NPSCQTSGLL SQWMHTTSGH EGHKQHRSQT LPIIRGKNAL
1460 1470 1480 1490 1500
SNPKLLQMLD NSMNSNSNEI DIVHHVDTEA NIATEVCLTI LDLLSLFTQV
1510 1520 1530 1540 1550
HQRQLQQSDC QNSLMKRVFD TYMLFFQVNQ SASALKHVFA SLRLFVCKFP
1560 1570 1580 1590 1600
SAFFQGPADL CGSFCYEVLK CCNHRSRLTQ MEASALLYFF MRKNFEFNKQ
1610 1620 1630 1640 1650
KSIVRSHLQL IKAVSQLIAD AGIGGSRFQH SLAITNNFAN GDKQMKNSNF
1660 1670 1680 1690 1700
PAEVKDLTKR IRTVLMATAQ MKEHEKDPEM LVDLQYSLAN SYASTPELRR
1710 1720 1730 1740 1750
TWLESMAKIH ARNGDLSEAA MCYIHIAALI AEYLKRKGYW KMEKICTPPL
1760 1770 1780 1790 1800
LPEDTQPCDS NLLLTTPGGG SMFSMGWPAF LSITPNIKEE GAMKEDSGMQ
1810 1820 1830 1840 1850
DTPYNENILV EQLYMCVEFL WKSERYELIA DVNKPIIAVF EKQRDFKKLS
1860 1870 1880 1890 1900
DLYYDIHRSY LKVAEVVNSE KRLFGRYYRV AFYGQAVGFF EEEEGKEYIY
1910 1920 1930 1940 1950
KEPKLTGLSE ISQRLLKLYA DKFGADNVKI IQDSNKVNPK DLDPKYAYIQ
1960 1970 1980 1990 2000
VTYVTPFFEE KEIEDRKTDF EMHHNINRFV FETPFTLSGK KHGGVAEQCK
2010 2020 2030 2040 2050
RRTVLTTSHL FPYVKKRIQV ISQSSTELNP IEVAIDEMSR KVSELNQLCT
2060 2070 2080 2090 2100
TEEVDMIRLQ LKLQGSVSVK VNAGPMAYAR AFLEETNAKK YPDNQVKLLK
2110 2120 2130 2140 2150
EIFRQFADAC GQALDVNERL IKEDQLEYQE ELRSHYKDML SELSAIMNEQ
Length:2,150
Mass (Da):245,758
Last modified:January 9, 2007 - v3
Checksum:iD7CDA1FE6476AB0E
GO
Isoform 2 (identifier: Q8BZN6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1739-1771: Missing.
     2150-2150: Q → LCRGPCLYSF...KFLQCSCLPC

Note: No experimental confirmation available.
Show »
Length:2,222
Mass (Da):253,466
Checksum:i83B60277F1092B94
GO
Isoform 3 (identifier: Q8BZN6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1739-1771: Missing.
     2150-2150: Q → LCRGPCLYSF...RKWLFYKGNL

Note: No experimental confirmation available.
Show »
Length:2,251
Mass (Da):257,396
Checksum:iE767B4733602DE79
GO
Isoform 4 (identifier: Q8BZN6-4) [UniParc]FASTAAdd to basket
Also known as: DOCK10.21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MAGERTRRFTRSLLRPGQAAELRHSAASAAAVAVSSRQQQRQ → MSFRGKEFWKRRRTVKRVNPEGIHKAGAQ
     2150-2150: Q → QITGRDDPAKCGVERPYTTRVTSKGTAAVPVVSISSSAEV

Show »
Length:2,176
Mass (Da):248,609
Checksum:i9619B22EFE8000A6
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QM99E9QM99_MOUSE
Dedicator of cytokinesis protein 10
Dock10
2,187Annotation score:
A0A087WQ86A0A087WQ86_MOUSE
Dedicator of cytokinesis protein 10
Dock10
2,175Annotation score:
A0A087WRP5A0A087WRP5_MOUSE
Dedicator of cytokinesis protein 10
Dock10
2,151Annotation score:
A0A0R4J2B7A0A0R4J2B7_MOUSE
Dedicator of cytokinesis protein 10
Dock10
1,816Annotation score:
A0A087WS26A0A087WS26_MOUSE
Dedicator of cytokinesis protein 10
Dock10
564Annotation score:
Q8BLX9Q8BLX9_MOUSE
Dedicator of cytokinesis protein 10
Dock10
373Annotation score:
A0A087WQA1A0A087WQA1_MOUSE
Dedicator of cytokinesis protein 10
Dock10
546Annotation score:

Sequence cautioni

The sequence BAC28567 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1886 – 1887Missing in ADK73961 (PubMed:21514340).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0588211 – 42MAGER…QQQRQ → MSFRGKEFWKRRRTVKRVNP EGIHKAGAQ in isoform 4. Add BLAST42
Alternative sequenceiVSP_0077181739 – 1771Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_0222882150Q → LCRGPCLYSFCASVSSISLS TVSKSDYGQGRPSKVRSGAT LHHTCNQGDRGCTCGLHLIQ CGGLRGTLEHPMHLSENSLN VLQLISGKKKIDLIYLKFLQ CSCLPC in isoform 2. 1 Publication1
Alternative sequenceiVSP_0222272150Q → LCRGPCLYSFCASVSSISLS TVSKSGTSFSLYVYPVLQPP VHPPLLITSPVPQSALVAQL LLRLHCHLKTRHVDSLAFKK KTHAPSSPKCIFELFQFFKT KTQNVFMILQNIKEKHRPGV EEERNRKWLFYKGNL in isoform 3. 1 Publication1
Alternative sequenceiVSP_0588222150Q → QITGRDDPAKCGVERPYTTR VTSKGTAAVPVVSISSSAEV in isoform 4. 1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
GU797481 mRNA Translation: ADK73961.1
AC124672 Genomic DNA No translation available.
AC132387 Genomic DNA No translation available.
AK122347 mRNA Translation: BAC65629.1
AK034064 mRNA Translation: BAC28567.1 Different initiation.
RefSeqiNP_001272856.1, NM_001285927.1
NP_780500.2, NM_175291.4
UniGeneiMm.133473

Genome annotation databases

GeneIDi210293
KEGGimmu:210293
UCSCiuc007brf.1 mouse [Q8BZN6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
GU797481 mRNA Translation: ADK73961.1
AC124672 Genomic DNA No translation available.
AC132387 Genomic DNA No translation available.
AK122347 mRNA Translation: BAC65629.1
AK034064 mRNA Translation: BAC28567.1 Different initiation.
RefSeqiNP_001272856.1, NM_001285927.1
NP_780500.2, NM_175291.4
UniGeneiMm.133473

3D structure databases

ProteinModelPortaliQ8BZN6
SMRiQ8BZN6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229145, 2 interactors
IntActiQ8BZN6, 1 interactor
STRINGi10090.ENSMUSP00000077099

PTM databases

iPTMnetiQ8BZN6
PhosphoSitePlusiQ8BZN6

Proteomic databases

EPDiQ8BZN6
PaxDbiQ8BZN6
PeptideAtlasiQ8BZN6
PRIDEiQ8BZN6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi210293
KEGGimmu:210293
UCSCiuc007brf.1 mouse [Q8BZN6-2]

Organism-specific databases

CTDi55619
MGIiMGI:2146320 Dock10
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
HOGENOMiHOG000231373
HOVERGENiHBG107819
InParanoidiQ8BZN6
KOiK21853
PhylomeDBiQ8BZN6

Miscellaneous databases

ChiTaRSiDock10 mouse
PROiPR:Q8BZN6
SOURCEiSearch...

Gene expression databases

CleanExiMM_DOCK10

Family and domain databases

CDDicd08697 C2_Dock-D, 1 hit
Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR23317 PTHR23317, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDOC10_MOUSE
AccessioniPrimary (citable) accession number: Q8BZN6
Secondary accession number(s): F1AHI9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: January 9, 2007
Last modified: November 7, 2018
This is version 126 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again