Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (16 Oct 2019)
Sequence version 3 (09 Jan 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Dedicator of cytokinesis protein 10

Gene

Dock10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Guanine nucleotide-exchange factor (GEF) that activates CDC42 and RAC1 by exchanging bound GDP for free GTP. Essential for dendritic spine morphogenesis in Purkinje cells and in hippocampal neurons, via a CDC42-mediated pathway (PubMed:25851601). Sustains B-cell lymphopoiesis in secondary lymphoid tissues and regulates FCER2/CD23 expression (PubMed:27502165).2 Publications

Miscellaneous

'Zizim' means 'spike' in Hebrew.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-983231 Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dedicator of cytokinesis protein 10Curated
Alternative name(s):
Zizimin-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dock10Imported
Synonyms:Kiaa0694, Ziz3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2146320 Dock10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Nucleus, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Knockout mice are viable and fertile (PubMed:25729399, PubMed:27502165). They show decreased numbers of B-cells in spleen, both follicular B-cells and marginal zone B-cells, and in peripheral blood, but not in bone marrow (PubMed:25729399, PubMed:27502165). Their percentage of splenic CD8+ T-cells is decreased comparing to wild types (PubMed:25729399).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001900031 – 2150Dedicator of cytokinesis protein 10Add BLAST2150

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei196PhosphothreonineCombined sources1
Modified residuei302PhosphoserineCombined sources1
Modified residuei368PhosphothreonineCombined sources1
Modified residuei834N6-acetyllysineBy similarity1
Modified residuei877PhosphoserineCombined sources1
Modified residuei1232PhosphoserineBy similarity1
Modified residuei1251PhosphoserineCombined sources1
Modified residuei1257PhosphoserineCombined sources1
Modified residuei1292PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1318PhosphoserineCombined sources1
Modified residuei1406PhosphothreonineCombined sources1
Modified residuei1440PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8BZN6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8BZN6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BZN6

PeptideAtlas

More...
PeptideAtlasi
Q8BZN6

PRoteomics IDEntifications database

More...
PRIDEi
Q8BZN6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BZN6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BZN6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8BZN6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, lung, spleen, mesenteric lymph nodes (MLN) and thymus (PubMed:15710388, PubMed:25729399). Expressed by B and T splenocytes (PubMed:21514340). In brain, expressed by Purkinje cells during postnatal development and hippocampal neurons (PubMed:25851601).4 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At early postnatal stages, expressed broadly in the cerebellum and from P15 the expression becomes restricted to Purkinje cells.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 4 (but not isoform 1) is highly induced by IL4 in B splenocytes, but not T splenocytes.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
229145, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8BZN6, 2 interactors

Molecular INTeraction database

More...
MINTi
Q8BZN6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000077099

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BZN6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini181 – 290PHPROSITE-ProRule annotationAdd BLAST110
Domaini672 – 850DHR-1PROSITE-ProRule annotationAdd BLAST179
Domaini1690 – 2150DHR-2PROSITE-ProRule annotationAdd BLAST461

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DHR-2 domain may mediate some GEF activity.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DOCK family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1997 Eukaryota
ENOG410XNVY LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231373

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BZN6

KEGG Orthology (KO)

More...
KOi
K21853

Database of Orthologous Groups

More...
OrthoDBi
20156at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BZN6

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08697 C2_Dock-D, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR23317 PTHR23317, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BZN6-1) [UniParc]FASTAAdd to basket
Also known as: DOCK10.11 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGERTRRFT RSLLRPGQAA ELRHSAASAA AVAVSSRQQQ RQEKPRLLDP
60 70 80 90 100
LDYETVIEEL EKTYRDDPLQ DLLFFPSDDF STATVSWDIR TLYSTVPEEA
110 120 130 140 150
EHRAESLLVK EACKFYSSQW YVVNYKYEQY SGDIRQLPRA EHKPEKLPSH
160 170 180 190 200
SFEVDHEDAD KDEDTTSHSS SKGGGGAGGT GVFKSGWLYK GNFNSTVNNT
210 220 230 240 250
VTVRSFKKRY FQLTQLPDNS YIMNFYKDEK ISKEPKGCIF LDSCTGVVQN
260 270 280 290 300
NRLRKYAFEL KMNDLTYFVL AAETESDMDE WIHTLNRILQ ISPEGPLQGR
310 320 330 340 350
KSAELAELGL DPLDNCVTCE CTLEETDSSE NSLHPDFAKY LTETEDTVKT
360 370 380 390 400
TRNMGRLNLF SLDPDIDTLK LQKRDSFENE LMIKPFEEKA AKRIMIICRA
410 420 430 440 450
LNFNLQGCVT ENEYDPVTNI EPFFVSVALY DLRDNRKISA DFHVDLNHPA
460 470 480 490 500
VRQMLSGTPP ALENGNIDTG TPRQSEEPHI KGLPEEWLKF PKQAVFSVSD
510 520 530 540 550
PHSEIVLVAK VEKVLMGNIG SGAEPYIKNP DSNKFAQKIL KSNRQFCSKL
560 570 580 590 600
GKYRMPFAWA VRSVFKDNQG NVDRDSRFSP LYRQESSKMS SEDLLKLVSD
610 620 630 640 650
YRRADRISKM QSIPGSLDIA VDNIPLEHPN CVTSSFIPVK PFNVSAQSEP
660 670 680 690 700
TVEVEEFIYD STKYCRPYRV YKNQIYVYPK HLKYDSQKCF NKARNITVCI
710 720 730 740 750
EFKNSDDDGA KPMKCIYGKP GGPLFTSSAY TAVLHHSQNP DFSDEVKIEL
760 770 780 790 800
PTQLHGKHHL LFSFYHITCD INAKANAKKK EALETSVGYA WLPLMKHDQI
810 820 830 840 850
ASQEYNIPIA TTLPPNYLSI QDPTSAKHGG SDIKWVDGGK PLFKVSTFVV
860 870 880 890 900
STVNTQDPHV NAFFRQCQKR EKDMSQSPTS SFVRACKNLL NVDKIHSIMS
910 920 930 940 950
FLPIILNQLF KILVQNEEDE ITATVTRVLA DIVAKCHEEQ LDHSVQSYIK
960 970 980 990 1000
FVFKTKSYKE RTIHEELAKN LSDLLKSNDS TIVKHVLEHS WFFFAIILKS
1010 1020 1030 1040 1050
MAQHLIDTNK IQLPRAQRFP ESYQSELDNL VMGLCDHVIW KCKEAPEETK
1060 1070 1080 1090 1100
RANHSVARFL KRCFTFMDRG FVFKMVNNYI SMFSSGEFKT LCQYKFDFLQ
1110 1120 1130 1140 1150
EVCQHEHFIP LCLPIRSANI PDPLTPSESI RELHASDMPE YSVTNEFCRK
1160 1170 1180 1190 1200
HFLIGILLRE VGFALQEDQD IRHLALAVLK NLMAKHSFDD RYREPRKQAQ
1210 1220 1230 1240 1250
IASLYMPLYG MLLDNMPRIY LKDLYPFTVN TSNQGSRDDL STNGGFQTQT
1260 1270 1280 1290 1300
SMKHATSVDT SFSKDVLNSI AAFSSIAIST VNHADSRASL ASLDSNPSTT
1310 1320 1330 1340 1350
EKSSEKTDNC EKIPRPLSLI GSTLRFDKLD QAETRSLLMC FLHIMKTISD
1360 1370 1380 1390 1400
ETLIAYWQRA PSPEVSDFFS ILDVCLQNFR YLGKRNIIRK IAAAFKFVQS
1410 1420 1430 1440 1450
TQNNGTLKGS NPSCQTSGLL SQWMHTTSGH EGHKQHRSQT LPIIRGKNAL
1460 1470 1480 1490 1500
SNPKLLQMLD NSMNSNSNEI DIVHHVDTEA NIATEVCLTI LDLLSLFTQV
1510 1520 1530 1540 1550
HQRQLQQSDC QNSLMKRVFD TYMLFFQVNQ SASALKHVFA SLRLFVCKFP
1560 1570 1580 1590 1600
SAFFQGPADL CGSFCYEVLK CCNHRSRLTQ MEASALLYFF MRKNFEFNKQ
1610 1620 1630 1640 1650
KSIVRSHLQL IKAVSQLIAD AGIGGSRFQH SLAITNNFAN GDKQMKNSNF
1660 1670 1680 1690 1700
PAEVKDLTKR IRTVLMATAQ MKEHEKDPEM LVDLQYSLAN SYASTPELRR
1710 1720 1730 1740 1750
TWLESMAKIH ARNGDLSEAA MCYIHIAALI AEYLKRKGYW KMEKICTPPL
1760 1770 1780 1790 1800
LPEDTQPCDS NLLLTTPGGG SMFSMGWPAF LSITPNIKEE GAMKEDSGMQ
1810 1820 1830 1840 1850
DTPYNENILV EQLYMCVEFL WKSERYELIA DVNKPIIAVF EKQRDFKKLS
1860 1870 1880 1890 1900
DLYYDIHRSY LKVAEVVNSE KRLFGRYYRV AFYGQAVGFF EEEEGKEYIY
1910 1920 1930 1940 1950
KEPKLTGLSE ISQRLLKLYA DKFGADNVKI IQDSNKVNPK DLDPKYAYIQ
1960 1970 1980 1990 2000
VTYVTPFFEE KEIEDRKTDF EMHHNINRFV FETPFTLSGK KHGGVAEQCK
2010 2020 2030 2040 2050
RRTVLTTSHL FPYVKKRIQV ISQSSTELNP IEVAIDEMSR KVSELNQLCT
2060 2070 2080 2090 2100
TEEVDMIRLQ LKLQGSVSVK VNAGPMAYAR AFLEETNAKK YPDNQVKLLK
2110 2120 2130 2140 2150
EIFRQFADAC GQALDVNERL IKEDQLEYQE ELRSHYKDML SELSAIMNEQ
Length:2,150
Mass (Da):245,758
Last modified:January 9, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD7CDA1FE6476AB0E
GO
Isoform 2 (identifier: Q8BZN6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1739-1771: Missing.
     2150-2150: Q → LCRGPCLYSF...KFLQCSCLPC

Note: No experimental confirmation available.
Show »
Length:2,222
Mass (Da):253,466
Checksum:i83B60277F1092B94
GO
Isoform 3 (identifier: Q8BZN6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1739-1771: Missing.
     2150-2150: Q → LCRGPCLYSF...RKWLFYKGNL

Note: No experimental confirmation available.
Show »
Length:2,251
Mass (Da):257,396
Checksum:iE767B4733602DE79
GO
Isoform 4 (identifier: Q8BZN6-4) [UniParc]FASTAAdd to basket
Also known as: DOCK10.21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MAGERTRRFTRSLLRPGQAAELRHSAASAAAVAVSSRQQQRQ → MSFRGKEFWKRRRTVKRVNPEGIHKAGAQ
     2150-2150: Q → QITGRDDPAKCGVERPYTTRVTSKGTAAVPVVSISSSAEV

Show »
Length:2,176
Mass (Da):248,609
Checksum:i9619B22EFE8000A6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QM99E9QM99_MOUSE
Dedicator of cytokinesis protein 10
Dock10
2,187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQ86A0A087WQ86_MOUSE
Dedicator of cytokinesis protein 10
Dock10
2,175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WRP5A0A087WRP5_MOUSE
Dedicator of cytokinesis protein 10
Dock10
2,151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J2B7A0A0R4J2B7_MOUSE
Dedicator of cytokinesis protein 10
Dock10
1,816Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQA1A0A087WQA1_MOUSE
Dedicator of cytokinesis protein 10
Dock10
546Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8BLX9Q8BLX9_MOUSE
Dedicator of cytokinesis protein 10
Dock10
373Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WS26A0A087WS26_MOUSE
Dedicator of cytokinesis protein 10
Dock10
564Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC28567 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1886 – 1887Missing in ADK73961 (PubMed:21514340).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0588211 – 42MAGER…QQQRQ → MSFRGKEFWKRRRTVKRVNP EGIHKAGAQ in isoform 4. Add BLAST42
Alternative sequenceiVSP_0077181739 – 1771Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_0222882150Q → LCRGPCLYSFCASVSSISLS TVSKSDYGQGRPSKVRSGAT LHHTCNQGDRGCTCGLHLIQ CGGLRGTLEHPMHLSENSLN VLQLISGKKKIDLIYLKFLQ CSCLPC in isoform 2. 1 Publication1
Alternative sequenceiVSP_0222272150Q → LCRGPCLYSFCASVSSISLS TVSKSGTSFSLYVYPVLQPP VHPPLLITSPVPQSALVAQL LLRLHCHLKTRHVDSLAFKK KTHAPSSPKCIFELFQFFKT KTQNVFMILQNIKEKHRPGV EEERNRKWLFYKGNL in isoform 3. 1 Publication1
Alternative sequenceiVSP_0588222150Q → QITGRDDPAKCGVERPYTTR VTSKGTAAVPVVSISSSAEV in isoform 4. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
GU797481 mRNA Translation: ADK73961.1
AC124672 Genomic DNA No translation available.
AC132387 Genomic DNA No translation available.
AK122347 mRNA Translation: BAC65629.1
AK034064 mRNA Translation: BAC28567.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_001272856.1, NM_001285927.1
NP_780500.2, NM_175291.4

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
210293

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:210293

UCSC genome browser

More...
UCSCi
uc007brf.1 mouse [Q8BZN6-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
GU797481 mRNA Translation: ADK73961.1
AC124672 Genomic DNA No translation available.
AC132387 Genomic DNA No translation available.
AK122347 mRNA Translation: BAC65629.1
AK034064 mRNA Translation: BAC28567.1 Different initiation.
RefSeqiNP_001272856.1, NM_001285927.1
NP_780500.2, NM_175291.4

3D structure databases

SMRiQ8BZN6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi229145, 2 interactors
IntActiQ8BZN6, 2 interactors
MINTiQ8BZN6
STRINGi10090.ENSMUSP00000077099

PTM databases

iPTMnetiQ8BZN6
PhosphoSitePlusiQ8BZN6
SwissPalmiQ8BZN6

Proteomic databases

EPDiQ8BZN6
jPOSTiQ8BZN6
PaxDbiQ8BZN6
PeptideAtlasiQ8BZN6
PRIDEiQ8BZN6

Genome annotation databases

GeneIDi210293
KEGGimmu:210293
UCSCiuc007brf.1 mouse [Q8BZN6-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55619
MGIiMGI:2146320 Dock10

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
HOGENOMiHOG000231373
InParanoidiQ8BZN6
KOiK21853
OrthoDBi20156at2759
PhylomeDBiQ8BZN6

Enzyme and pathway databases

ReactomeiR-MMU-983231 Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dock10 mouse

Protein Ontology

More...
PROi
PR:Q8BZN6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd08697 C2_Dock-D, 1 hit
Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR23317 PTHR23317, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDOC10_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BZN6
Secondary accession number(s): F1AHI9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: January 9, 2007
Last modified: October 16, 2019
This is version 131 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again