Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (18 Sep 2019)
Sequence version 2 (10 Jan 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-dependent secretion activator 2

Gene

Cadps2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates neurotrophin release from granule cells leading to regulate cell differentiation and survival during cerebellar development. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processExocytosis, Protein transport, Transport
LigandCalcium, Lipid-binding, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-dependent secretion activator 2
Alternative name(s):
Calcium-dependent activator protein for secretion 2
Short name:
CAPS-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cadps2
Synonyms:Caps2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443963 Cadps2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538691 – 1297Calcium-dependent secretion activator 2Add BLAST1297

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei61PhosphoserineCombined sources1
Modified residuei1291PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BYR5

PeptideAtlas

More...
PeptideAtlasi
Q8BYR5

PRoteomics IDEntifications database

More...
PRIDEi
Q8BYR5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BYR5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BYR5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8BYR5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in cerebellum. Also expressed in non-neuronal tissues such as lung, spleen, testis, uterus and ovary. Highly expressed in brain. In brain, it is highly expressed in cerebellum, cortex, olfactory bulb, CA1/CA2 regions of the hippocampus, and dentate gyrus, and weakly or not expressed in the CA3 regions of the hippocampus, striatum, thalamus, superior and inferior colliculi, and brain stem. Not present in adult adrenal glands. Isoform 4, but not isoform 3, is highly expressed in postnatal and adult stages of cerebellum.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at stable level during brain development, with a higher level in embryonic brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000017978 Expressed in 224 organ(s), highest expression level in habenula

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BYR5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BYR5 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with the dopamine receptor DRD2 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8BYR5, 5 interactors

Molecular INTeraction database

More...
MINTi
Q8BYR5

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000018122

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BYR5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini370 – 451C2Add BLAST82
Domaini491 – 594PHPROSITE-ProRule annotationAdd BLAST104
Domaini886 – 1057MHD1PROSITE-ProRule annotationAdd BLAST172

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni756 – 1075Interaction with DRD2By similarityAdd BLAST320

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3543 Eukaryota
ENOG410Y0FD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00590000083094

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BYR5

KEGG Orthology (KO)

More...
KOi
K19933

Database of Orthologous Groups

More...
OrthoDBi
138870at2759

TreeFam database of animal gene trees

More...
TreeFami
TF312963

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033227 CAPS
IPR010439 CAPS_dom
IPR014770 Munc13_1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR12166 PTHR12166, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06292 DUF1041, 1 hit
PF00169 PH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01145 DUF1041, 1 hit
SM00233 PH, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51258 MHD1, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BYR5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLDPSSSEEE SDEGLEEESR EVLVAPGVSQ RAPPAAAREG RRDAPGRSGG
60 70 80 90 100
GSGGGAARPV SPSPSVLSEG RNEPELQLDE EQERRIRLQL YVFVVRCIAY
110 120 130 140 150
PFNAKQPTDM ARRQQKLNKQ QLQLLKERFQ AFLNGETQIV ADEAFCNAVR
160 170 180 190 200
SYYEVFLKSD RVARMVQSGG CSANDFREVF KKNIEKRVRS LPEIDGLSKE
210 220 230 240 250
TVLSSWIAKY DAIYRGEEDL CKQPNRMTLS AVSELILSKE QLYEMFQQIL
260 270 280 290 300
GIKKLEHQLL YNACQLDNAD EQAAQIRREL DGRLQLAEKM AKERRFPRFI
310 320 330 340 350
SKEMESMYIE ELRASVNLLM ANLESLPVSK GGPEFKLQKL KRSQNSAFLD
360 370 380 390 400
LGDENEIQLS KSDVVLSFTL EIVIMEVQGL KSVAPNRIVY CTMEVEGGEK
410 420 430 440 450
LQTDQAEASR PQWGTQGDFN TTHPRPVVKV KLFTESTGVL ALEDKELGRV
460 470 480 490 500
VLYPTSNSSK SAELHRMTVP KNSQDSDLKI KLAVRMDKPA HMKHSGYLYA
510 520 530 540 550
LGQKVWKRWK KRYFVLVQVS QYTFAMCSYR EKKSEPQELM QLEGYTVDYT
560 570 580 590 600
DPHPGLQGGQ VFFNAVKEGD TVIFASDDEQ DRILWVQAMY RATGQSYKPV
610 620 630 640 650
PAVQSQKLNP KGGALHADAQ LYADRFQKHG MDEFISASPC KLDHAFLFRI
660 670 680 690 700
LQRQTLDHRL NDSYSCLGWF SPGQVFVLDE YCARYGVRGC HRHLCYLTEL
710 720 730 740 750
MEHSENGAVI DPTLLHYSFA FCASHVHGNR PDGIGTVSVE EKERFEEIKD
760 770 780 790 800
RLSSLLENQI SHFRYCFPFG RPEGALKATL SLLERVLMKD IATPIPAEEV
810 820 830 840 850
KKVVRKCLEK AALINYTRLT EYAKIEETMN QATPARKLEE VLHLAELCIE
860 870 880 890 900
VLQQNEEHHA EGREAFAWWP DLLAEHAEKF WALFTVDMDT ALEAQPQDSW
910 920 930 940 950
DSFPLFQLLN NFLRNDTLLC NGKFHKHLQE IFVPLVVRYV DLMESAIAQS
960 970 980 990 1000
IHRGFEQETW QPVKNIANSL PNVALPKVPS LPLNLPQIPS FSTPPWMASL
1010 1020 1030 1040 1050
YESTNGSTTS EDLFWKLDAL QMFVFDLHWP EQEFAHHLEQ RLKLMASDMI
1060 1070 1080 1090 1100
EACVKRTRTA FELKLQKANK TTDLRIPASV CTMFNVLVDA KKQSTKLCAL
1110 1120 1130 1140 1150
DGGQEQQYHS KIDDLIDNTV KEIIALLVSK FVSVLEGVLS KLSRYDEGTF
1160 1170 1180 1190 1200
FSSILSFTVK AAAKYVDVPK PGMDLADTYI MFVRQNQDIL REKVNEEMYI
1210 1220 1230 1240 1250
EKLFDQWYSN SMKVICVWLA DRLDLQLHIY QLKTLIKIVK KTYRDFRLQG
1260 1270 1280 1290
VLEGTLNSKT YDTLHRRLTV EEATASVSEG GGLQGITMKD SDEEEEG
Length:1,297
Mass (Da):147,841
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i34220B10B4429D58
GO
Isoform 2 (identifier: Q8BYR5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-826: E → EGPAEKET

Show »
Length:1,304
Mass (Da):148,553
Checksum:i1F0D3254F416E062
GO
Isoform 3 (identifier: Q8BYR5-3) [UniParc]FASTAAdd to basket
Also known as: CAPS2b

The sequence of this isoform differs from the canonical sequence as follows:
     26-55: PGVSQRAPPAAAREGRRDAPGRSGGGSGGG → R
     826-826: E → EGPAEKET

Show »
Length:1,275
Mass (Da):145,939
Checksum:i77B46E2B0891FD37
GO
Isoform 4 (identifier: Q8BYR5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-826: E → EGPAEKET
     964-1004: KNIANSLPNVALPKVPSLPLNLPQIPSFSTPPWMASLYEST → N

Show »
Length:1,264
Mass (Da):144,251
Checksum:i1889D4B8E1FD0E10
GO
Isoform 5 (identifier: Q8BYR5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     861-863: Missing.
     964-1004: KNIANSLPNVALPKVPSLPLNLPQIPSFSTPPWMASLYEST → N
     1105-1105: E → EFRNQW

Show »
Length:1,259
Mass (Da):143,928
Checksum:iAAE420C17BCDDE49
GO
Isoform 6 (identifier: Q8BYR5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     731-768: PDGIGTVSVE...QISHFRYCFP → FLSFFFFFFF...TQRSEHPDSN
     769-1297: Missing.

Show »
Length:768
Mass (Da):87,464
Checksum:i97349220BD09B26C
GO
Isoform 7 (identifier: Q8BYR5-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-173: FLKSDRVARMVQSGGCSA → SLQSCFGTVVLSKTISLV
     174-1297: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,057
Checksum:iEAB0F96B45F41CCB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q5C0E9Q5C0_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,275Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q835E9Q835_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,304Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R1C6S4R1C6_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,275Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0M3HEP6A0A0M3HEP6_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,297Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6SH36F6SH36_MOUSE
Calcium-dependent secretion activat...
Cadps2
899Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB58720 differs from that shown. Reason: Frameshift at positions 220, 237, 1288 and 1297.Curated
Isoform 6 : The sequence AAH55462 differs from that shown. Reason: Frameshift at position 739.Curated
The sequence AAH59274 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti99A → V in BAC30047 (PubMed:16141072).Curated1
Sequence conflicti106Q → H in BAC30047 (PubMed:16141072).Curated1
Sequence conflicti133 – 134LN → SQ in AAL67937 (PubMed:12659812).Curated2
Sequence conflicti162V → M in BAC32801 (PubMed:16141072).Curated1
Sequence conflicti411 – 412PQ → AK in AAB58720 (Ref. 4) Curated2
Sequence conflicti493K → E in AAB58720 (Ref. 4) Curated1
Sequence conflicti517V → E in AAB58720 (Ref. 4) Curated1
Sequence conflicti684R → P in AAB58720 (Ref. 4) Curated1
Sequence conflicti690C → F in AAB58720 (Ref. 4) Curated1
Sequence conflicti702E → G in AAB58720 (Ref. 4) Curated1
Sequence conflicti1073D → N in AAB58720 (Ref. 4) Curated1
Sequence conflicti1292D → E in AAH59274 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01681926 – 55PGVSQ…GSGGG → R in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_016820156 – 173FLKSD…GGCSA → SLQSCFGTVVLSKTISLV in isoform 7. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_016821174 – 1297Missing in isoform 7. 1 PublicationAdd BLAST1124
Alternative sequenceiVSP_016822731 – 768PDGIG…RYCFP → FLSFFFFFFFPQSCVSFRLF TEWQSVEGTQRSEHPDSN in isoform 6. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_016823769 – 1297Missing in isoform 6. 2 PublicationsAdd BLAST529
Alternative sequenceiVSP_016824826E → EGPAEKET in isoform 2, isoform 3 and isoform 4. 5 Publications1
Alternative sequenceiVSP_016825861 – 863Missing in isoform 5. 1 Publication3
Alternative sequenceiVSP_016826964 – 1004KNIAN…LYEST → N in isoform 4 and isoform 5. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_0168271105E → EFRNQW in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY072800 mRNA Translation: AAL67937.1
AB098623 mRNA Translation: BAD05017.1
AK038568 mRNA Translation: BAC30047.1
AK042634 mRNA Translation: BAC31314.1
AK046596 mRNA Translation: BAC32801.1
AF000969 mRNA Translation: AAB58720.2 Frameshift.
BC047394 mRNA Translation: AAH47394.1
BC055462 mRNA Translation: AAH55462.1 Frameshift.
BC059274 mRNA Translation: AAH59274.1 Different initiation.
BC080854 mRNA Translation: AAH80854.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39439.1 [Q8BYR5-2]
CCDS57411.1 [Q8BYR5-5]
CCDS57412.1 [Q8BYR5-4]
CCDS57413.1 [Q8BYR5-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001239034.1, NM_001252105.1 [Q8BYR5-4]
XP_006505175.1, XM_006505112.1 [Q8BYR5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000018122; ENSMUSP00000018122; ENSMUSG00000017978 [Q8BYR5-2]
ENSMUST00000115356; ENSMUSP00000111013; ENSMUSG00000017978 [Q8BYR5-6]
ENSMUST00000115358; ENSMUSP00000111015; ENSMUSG00000017978 [Q8BYR5-4]
ENSMUST00000115361; ENSMUSP00000111018; ENSMUSG00000017978 [Q8BYR5-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
320405

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:320405

UCSC genome browser

More...
UCSCi
uc009bbe.2 mouse [Q8BYR5-4]
uc009bbg.2 mouse [Q8BYR5-5]
uc009bbh.3 mouse [Q8BYR5-6]
uc009bbm.2 mouse [Q8BYR5-7]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072800 mRNA Translation: AAL67937.1
AB098623 mRNA Translation: BAD05017.1
AK038568 mRNA Translation: BAC30047.1
AK042634 mRNA Translation: BAC31314.1
AK046596 mRNA Translation: BAC32801.1
AF000969 mRNA Translation: AAB58720.2 Frameshift.
BC047394 mRNA Translation: AAH47394.1
BC055462 mRNA Translation: AAH55462.1 Frameshift.
BC059274 mRNA Translation: AAH59274.1 Different initiation.
BC080854 mRNA Translation: AAH80854.1
CCDSiCCDS39439.1 [Q8BYR5-2]
CCDS57411.1 [Q8BYR5-5]
CCDS57412.1 [Q8BYR5-4]
CCDS57413.1 [Q8BYR5-6]
RefSeqiNP_001239034.1, NM_001252105.1 [Q8BYR5-4]
XP_006505175.1, XM_006505112.1 [Q8BYR5-1]

3D structure databases

SMRiQ8BYR5
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ8BYR5, 5 interactors
MINTiQ8BYR5
STRINGi10090.ENSMUSP00000018122

PTM databases

iPTMnetiQ8BYR5
PhosphoSitePlusiQ8BYR5
SwissPalmiQ8BYR5

Proteomic databases

PaxDbiQ8BYR5
PeptideAtlasiQ8BYR5
PRIDEiQ8BYR5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000018122; ENSMUSP00000018122; ENSMUSG00000017978 [Q8BYR5-2]
ENSMUST00000115356; ENSMUSP00000111013; ENSMUSG00000017978 [Q8BYR5-6]
ENSMUST00000115358; ENSMUSP00000111015; ENSMUSG00000017978 [Q8BYR5-4]
ENSMUST00000115361; ENSMUSP00000111018; ENSMUSG00000017978 [Q8BYR5-5]
GeneIDi320405
KEGGimmu:320405
UCSCiuc009bbe.2 mouse [Q8BYR5-4]
uc009bbg.2 mouse [Q8BYR5-5]
uc009bbh.3 mouse [Q8BYR5-6]
uc009bbm.2 mouse [Q8BYR5-7]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
93664
MGIiMGI:2443963 Cadps2

Phylogenomic databases

eggNOGiKOG3543 Eukaryota
ENOG410Y0FD LUCA
GeneTreeiENSGT00590000083094
InParanoidiQ8BYR5
KOiK19933
OrthoDBi138870at2759
TreeFamiTF312963

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8BYR5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000017978 Expressed in 224 organ(s), highest expression level in habenula
ExpressionAtlasiQ8BYR5 baseline and differential
GenevisibleiQ8BYR5 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033227 CAPS
IPR010439 CAPS_dom
IPR014770 Munc13_1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR12166 PTHR12166, 1 hit
PfamiView protein in Pfam
PF06292 DUF1041, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM01145 DUF1041, 1 hit
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS51258 MHD1, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAPS2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BYR5
Secondary accession number(s): O08903
, Q66JM7, Q6PCL7, Q76I88, Q7TMM6, Q80ZV8, Q8BL25, Q8BY04, Q8K3K6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: September 18, 2019
This is version 142 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again