Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-dependent secretion activator 2

Gene

Cadps2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. Regulates neurotrophin release from granule cells leading to regulate cell differentiation and survival during cerebellar development. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles.

GO - Molecular functioni

GO - Biological processi

  • cellular response to starvation Source: MGI
  • dense core granule exocytosis Source: InterPro
  • positive regulation of exocytosis Source: MGI
  • protein transport Source: UniProtKB-KW
  • synaptic vesicle priming Source: SynGO

Keywordsi

Biological processExocytosis, Protein transport, Transport
LigandCalcium, Lipid-binding, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-dependent secretion activator 2
Alternative name(s):
Calcium-dependent activator protein for secretion 2
Short name:
CAPS-2
Gene namesi
Name:Cadps2
Synonyms:Caps2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2443963 Cadps2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538691 – 1297Calcium-dependent secretion activator 2Add BLAST1297

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei61PhosphoserineCombined sources1
Modified residuei1291PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BYR5
PeptideAtlasiQ8BYR5
PRIDEiQ8BYR5

PTM databases

iPTMnetiQ8BYR5
PhosphoSitePlusiQ8BYR5

Expressioni

Tissue specificityi

Highly expressed in cerebellum. Also expressed in non-neuronal tissues such as lung, spleen, testis, uterus and ovary. Highly expressed in brain. In brain, it is highly expressed in cerebellum, cortex, olfactory bulb, CA1/CA2 regions of the hippocampus, and dentate gyrus, and weakly or not expressed in the CA3 regions of the hippocampus, striatum, thalamus, superior and inferior colliculi, and brain stem. Not present in adult adrenal glands. Isoform 4, but not isoform 3, is highly expressed in postnatal and adult stages of cerebellum.2 Publications

Developmental stagei

Expressed at stable level during brain development, with a higher level in embryonic brain.

Gene expression databases

BgeeiENSMUSG00000017978 Expressed in 224 organ(s), highest expression level in habenula
CleanExiMM_CADPS2
MM_CAPS2
ExpressionAtlasiQ8BYR5 baseline and differential
GenevisibleiQ8BYR5 MM

Interactioni

Subunit structurei

Homodimer. Interacts with the dopamine receptor DRD2 (By similarity).By similarity

Binary interactionsi

Protein-protein interaction databases

IntActiQ8BYR5, 5 interactors
MINTiQ8BYR5
STRINGi10090.ENSMUSP00000018122

Structurei

3D structure databases

ProteinModelPortaliQ8BYR5
SMRiQ8BYR5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini370 – 451C2Add BLAST82
Domaini491 – 594PHPROSITE-ProRule annotationAdd BLAST104
Domaini886 – 1057MHD1PROSITE-ProRule annotationAdd BLAST172

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni756 – 1075Interaction with DRD2By similarityAdd BLAST320

Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids.By similarity

Phylogenomic databases

eggNOGiKOG3543 Eukaryota
ENOG410Y0FD LUCA
GeneTreeiENSGT00590000083094
HOVERGENiHBG080678
InParanoidiQ8BYR5
KOiK19933
TreeFamiTF312963

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033227 CAPS
IPR010439 CAPS_dom
IPR014770 Munc13_1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR12166 PTHR12166, 1 hit
PfamiView protein in Pfam
PF06292 DUF1041, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM01145 DUF1041, 1 hit
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS51258 MHD1, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BYR5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLDPSSSEEE SDEGLEEESR EVLVAPGVSQ RAPPAAAREG RRDAPGRSGG
60 70 80 90 100
GSGGGAARPV SPSPSVLSEG RNEPELQLDE EQERRIRLQL YVFVVRCIAY
110 120 130 140 150
PFNAKQPTDM ARRQQKLNKQ QLQLLKERFQ AFLNGETQIV ADEAFCNAVR
160 170 180 190 200
SYYEVFLKSD RVARMVQSGG CSANDFREVF KKNIEKRVRS LPEIDGLSKE
210 220 230 240 250
TVLSSWIAKY DAIYRGEEDL CKQPNRMTLS AVSELILSKE QLYEMFQQIL
260 270 280 290 300
GIKKLEHQLL YNACQLDNAD EQAAQIRREL DGRLQLAEKM AKERRFPRFI
310 320 330 340 350
SKEMESMYIE ELRASVNLLM ANLESLPVSK GGPEFKLQKL KRSQNSAFLD
360 370 380 390 400
LGDENEIQLS KSDVVLSFTL EIVIMEVQGL KSVAPNRIVY CTMEVEGGEK
410 420 430 440 450
LQTDQAEASR PQWGTQGDFN TTHPRPVVKV KLFTESTGVL ALEDKELGRV
460 470 480 490 500
VLYPTSNSSK SAELHRMTVP KNSQDSDLKI KLAVRMDKPA HMKHSGYLYA
510 520 530 540 550
LGQKVWKRWK KRYFVLVQVS QYTFAMCSYR EKKSEPQELM QLEGYTVDYT
560 570 580 590 600
DPHPGLQGGQ VFFNAVKEGD TVIFASDDEQ DRILWVQAMY RATGQSYKPV
610 620 630 640 650
PAVQSQKLNP KGGALHADAQ LYADRFQKHG MDEFISASPC KLDHAFLFRI
660 670 680 690 700
LQRQTLDHRL NDSYSCLGWF SPGQVFVLDE YCARYGVRGC HRHLCYLTEL
710 720 730 740 750
MEHSENGAVI DPTLLHYSFA FCASHVHGNR PDGIGTVSVE EKERFEEIKD
760 770 780 790 800
RLSSLLENQI SHFRYCFPFG RPEGALKATL SLLERVLMKD IATPIPAEEV
810 820 830 840 850
KKVVRKCLEK AALINYTRLT EYAKIEETMN QATPARKLEE VLHLAELCIE
860 870 880 890 900
VLQQNEEHHA EGREAFAWWP DLLAEHAEKF WALFTVDMDT ALEAQPQDSW
910 920 930 940 950
DSFPLFQLLN NFLRNDTLLC NGKFHKHLQE IFVPLVVRYV DLMESAIAQS
960 970 980 990 1000
IHRGFEQETW QPVKNIANSL PNVALPKVPS LPLNLPQIPS FSTPPWMASL
1010 1020 1030 1040 1050
YESTNGSTTS EDLFWKLDAL QMFVFDLHWP EQEFAHHLEQ RLKLMASDMI
1060 1070 1080 1090 1100
EACVKRTRTA FELKLQKANK TTDLRIPASV CTMFNVLVDA KKQSTKLCAL
1110 1120 1130 1140 1150
DGGQEQQYHS KIDDLIDNTV KEIIALLVSK FVSVLEGVLS KLSRYDEGTF
1160 1170 1180 1190 1200
FSSILSFTVK AAAKYVDVPK PGMDLADTYI MFVRQNQDIL REKVNEEMYI
1210 1220 1230 1240 1250
EKLFDQWYSN SMKVICVWLA DRLDLQLHIY QLKTLIKIVK KTYRDFRLQG
1260 1270 1280 1290
VLEGTLNSKT YDTLHRRLTV EEATASVSEG GGLQGITMKD SDEEEEG
Length:1,297
Mass (Da):147,841
Last modified:January 10, 2006 - v2
Checksum:i34220B10B4429D58
GO
Isoform 2 (identifier: Q8BYR5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-826: E → EGPAEKET

Show »
Length:1,304
Mass (Da):148,553
Checksum:i1F0D3254F416E062
GO
Isoform 3 (identifier: Q8BYR5-3) [UniParc]FASTAAdd to basket
Also known as: CAPS2b

The sequence of this isoform differs from the canonical sequence as follows:
     26-55: PGVSQRAPPAAAREGRRDAPGRSGGGSGGG → R
     826-826: E → EGPAEKET

Show »
Length:1,275
Mass (Da):145,939
Checksum:i77B46E2B0891FD37
GO
Isoform 4 (identifier: Q8BYR5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-826: E → EGPAEKET
     964-1004: KNIANSLPNVALPKVPSLPLNLPQIPSFSTPPWMASLYEST → N

Show »
Length:1,264
Mass (Da):144,251
Checksum:i1889D4B8E1FD0E10
GO
Isoform 5 (identifier: Q8BYR5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     861-863: Missing.
     964-1004: KNIANSLPNVALPKVPSLPLNLPQIPSFSTPPWMASLYEST → N
     1105-1105: E → EFRNQW

Show »
Length:1,259
Mass (Da):143,928
Checksum:iAAE420C17BCDDE49
GO
Isoform 6 (identifier: Q8BYR5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     731-768: PDGIGTVSVE...QISHFRYCFP → FLSFFFFFFF...TQRSEHPDSN
     769-1297: Missing.

Show »
Length:768
Mass (Da):87,464
Checksum:i97349220BD09B26C
GO
Isoform 7 (identifier: Q8BYR5-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-173: FLKSDRVARMVQSGGCSA → SLQSCFGTVVLSKTISLV
     174-1297: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):19,057
Checksum:iEAB0F96B45F41CCB
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q835E9Q835_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,304Annotation score:
E9Q5C0E9Q5C0_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,275Annotation score:
S4R1C6S4R1C6_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,275Annotation score:
F6SH36F6SH36_MOUSE
Calcium-dependent secretion activat...
Cadps2
899Annotation score:
A0A0M3HEP6A0A0M3HEP6_MOUSE
Calcium-dependent secretion activat...
Cadps2
1,297Annotation score:

Sequence cautioni

The sequence AAB58720 differs from that shown. Reason: Frameshift at positions 220, 237, 1288 and 1297.Curated
Isoform 6 : The sequence AAH55462 differs from that shown. Reason: Frameshift at position 739.Curated
The sequence AAH59274 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti99A → V in BAC30047 (PubMed:16141072).Curated1
Sequence conflicti106Q → H in BAC30047 (PubMed:16141072).Curated1
Sequence conflicti133 – 134LN → SQ in AAL67937 (PubMed:12659812).Curated2
Sequence conflicti162V → M in BAC32801 (PubMed:16141072).Curated1
Sequence conflicti411 – 412PQ → AK in AAB58720 (Ref. 4) Curated2
Sequence conflicti493K → E in AAB58720 (Ref. 4) Curated1
Sequence conflicti517V → E in AAB58720 (Ref. 4) Curated1
Sequence conflicti684R → P in AAB58720 (Ref. 4) Curated1
Sequence conflicti690C → F in AAB58720 (Ref. 4) Curated1
Sequence conflicti702E → G in AAB58720 (Ref. 4) Curated1
Sequence conflicti1073D → N in AAB58720 (Ref. 4) Curated1
Sequence conflicti1292D → E in AAH59274 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01681926 – 55PGVSQ…GSGGG → R in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_016820156 – 173FLKSD…GGCSA → SLQSCFGTVVLSKTISLV in isoform 7. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_016821174 – 1297Missing in isoform 7. 1 PublicationAdd BLAST1124
Alternative sequenceiVSP_016822731 – 768PDGIG…RYCFP → FLSFFFFFFFPQSCVSFRLF TEWQSVEGTQRSEHPDSN in isoform 6. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_016823769 – 1297Missing in isoform 6. 2 PublicationsAdd BLAST529
Alternative sequenceiVSP_016824826E → EGPAEKET in isoform 2, isoform 3 and isoform 4. 5 Publications1
Alternative sequenceiVSP_016825861 – 863Missing in isoform 5. 1 Publication3
Alternative sequenceiVSP_016826964 – 1004KNIAN…LYEST → N in isoform 4 and isoform 5. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_0168271105E → EFRNQW in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072800 mRNA Translation: AAL67937.1
AB098623 mRNA Translation: BAD05017.1
AK038568 mRNA Translation: BAC30047.1
AK042634 mRNA Translation: BAC31314.1
AK046596 mRNA Translation: BAC32801.1
AF000969 mRNA Translation: AAB58720.2 Frameshift.
BC047394 mRNA Translation: AAH47394.1
BC055462 mRNA Translation: AAH55462.1 Frameshift.
BC059274 mRNA Translation: AAH59274.1 Different initiation.
BC080854 mRNA Translation: AAH80854.1
CCDSiCCDS39439.1 [Q8BYR5-2]
CCDS57411.1 [Q8BYR5-5]
CCDS57412.1 [Q8BYR5-4]
CCDS57413.1 [Q8BYR5-6]
RefSeqiNP_001239034.1, NM_001252105.1 [Q8BYR5-4]
XP_006505175.1, XM_006505112.1 [Q8BYR5-1]
UniGeneiMm.259632

Genome annotation databases

EnsembliENSMUST00000018122; ENSMUSP00000018122; ENSMUSG00000017978 [Q8BYR5-2]
ENSMUST00000115356; ENSMUSP00000111013; ENSMUSG00000017978 [Q8BYR5-6]
ENSMUST00000115358; ENSMUSP00000111015; ENSMUSG00000017978 [Q8BYR5-4]
ENSMUST00000115361; ENSMUSP00000111018; ENSMUSG00000017978 [Q8BYR5-5]
GeneIDi320405
KEGGimmu:320405
UCSCiuc009bbe.2 mouse [Q8BYR5-4]
uc009bbg.2 mouse [Q8BYR5-5]
uc009bbh.3 mouse [Q8BYR5-6]
uc009bbm.2 mouse [Q8BYR5-7]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072800 mRNA Translation: AAL67937.1
AB098623 mRNA Translation: BAD05017.1
AK038568 mRNA Translation: BAC30047.1
AK042634 mRNA Translation: BAC31314.1
AK046596 mRNA Translation: BAC32801.1
AF000969 mRNA Translation: AAB58720.2 Frameshift.
BC047394 mRNA Translation: AAH47394.1
BC055462 mRNA Translation: AAH55462.1 Frameshift.
BC059274 mRNA Translation: AAH59274.1 Different initiation.
BC080854 mRNA Translation: AAH80854.1
CCDSiCCDS39439.1 [Q8BYR5-2]
CCDS57411.1 [Q8BYR5-5]
CCDS57412.1 [Q8BYR5-4]
CCDS57413.1 [Q8BYR5-6]
RefSeqiNP_001239034.1, NM_001252105.1 [Q8BYR5-4]
XP_006505175.1, XM_006505112.1 [Q8BYR5-1]
UniGeneiMm.259632

3D structure databases

ProteinModelPortaliQ8BYR5
SMRiQ8BYR5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BYR5, 5 interactors
MINTiQ8BYR5
STRINGi10090.ENSMUSP00000018122

PTM databases

iPTMnetiQ8BYR5
PhosphoSitePlusiQ8BYR5

Proteomic databases

PaxDbiQ8BYR5
PeptideAtlasiQ8BYR5
PRIDEiQ8BYR5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000018122; ENSMUSP00000018122; ENSMUSG00000017978 [Q8BYR5-2]
ENSMUST00000115356; ENSMUSP00000111013; ENSMUSG00000017978 [Q8BYR5-6]
ENSMUST00000115358; ENSMUSP00000111015; ENSMUSG00000017978 [Q8BYR5-4]
ENSMUST00000115361; ENSMUSP00000111018; ENSMUSG00000017978 [Q8BYR5-5]
GeneIDi320405
KEGGimmu:320405
UCSCiuc009bbe.2 mouse [Q8BYR5-4]
uc009bbg.2 mouse [Q8BYR5-5]
uc009bbh.3 mouse [Q8BYR5-6]
uc009bbm.2 mouse [Q8BYR5-7]

Organism-specific databases

CTDi93664
MGIiMGI:2443963 Cadps2

Phylogenomic databases

eggNOGiKOG3543 Eukaryota
ENOG410Y0FD LUCA
GeneTreeiENSGT00590000083094
HOVERGENiHBG080678
InParanoidiQ8BYR5
KOiK19933
TreeFamiTF312963

Miscellaneous databases

PROiPR:Q8BYR5
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000017978 Expressed in 224 organ(s), highest expression level in habenula
CleanExiMM_CADPS2
MM_CAPS2
ExpressionAtlasiQ8BYR5 baseline and differential
GenevisibleiQ8BYR5 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033227 CAPS
IPR010439 CAPS_dom
IPR014770 Munc13_1
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR12166 PTHR12166, 1 hit
PfamiView protein in Pfam
PF06292 DUF1041, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM01145 DUF1041, 1 hit
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS51258 MHD1, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCAPS2_MOUSE
AccessioniPrimary (citable) accession number: Q8BYR5
Secondary accession number(s): O08903
, Q66JM7, Q6PCL7, Q76I88, Q7TMM6, Q80ZV8, Q8BL25, Q8BY04, Q8K3K6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: November 7, 2018
This is version 137 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again