Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8BYK5 (PHAR3_MOUSE)

Entry version 126 (02 Dec 2020)
Sequence version 2 (28 Nov 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatase and actin regulator 3

Gene

Phactr3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Protein phosphatase inhibitor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatase and actin regulator 3
Alternative name(s):
Scaffold-associated PP1-inhibiting protein
Short name:
Scapinin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Phactr3
Synonyms:Scapin1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1921439, Phactr3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001266391 – 558Phosphatase and actin regulator 3Add BLAST558

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei69PhosphothreonineBy similarity1
Modified residuei229PhosphoserineCombined sources1
Modified residuei235PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8BYK5

PRoteomics IDEntifications database

More...PRIDEi		Q8BYK5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8BYK5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8BYK5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000027525, Expressed in lumbar subsegment of spinal cord and 150 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8BYK5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8BYK5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds PPP1CA and actin; thus inhibiting the protein phosphatase 1 (PP1) activity.

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		216561, 2 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000104543

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8BYK5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8BYK5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati92 – 117RPEL 1Add BLAST26
Repeati400 – 425RPEL 2Add BLAST26
Repeati438 – 463RPEL 3Add BLAST26
Repeati476 – 501RPEL 4Add BLAST26

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili449 – 485Sequence analysisAdd BLAST37

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi216 – 238Pro-richAdd BLAST23

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the phosphatase and actin regulator family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4339, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157562

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015753_3_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8BYK5

Identification of Orthologs from Complete Genome Data

More...OMAi		EDCVLQR

Database of Orthologous Groups

More...OrthoDBi		1205245at2759

TreeFam database of animal gene trees

More...TreeFami		TF316316

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029990, Phactr3
IPR004018, RPEL_repeat

The PANTHER Classification System

More...PANTHERi		PTHR12751:SF7, PTHR12751:SF7, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02755, RPEL, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00707, RPEL, 4 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51073, RPEL, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BYK5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAASEDGSSC LVSRGRSQSD PSFLSDSSAT STDAGENPDE MDQTPPARSE 
        60         70         80         90        100
PLVSGIRTPP VRRNSKLATL GRIFKPWKWR KKKNEKLKQT TSALEKKMAG 
       110        120        130        140        150
RQGREELIKQ GLLEMMEQDS ENKACSPKEG SQPVQSEPPA GEQETLTSEG 
       160        170        180        190        200
AQPGSPSASG TDQVSQDELL SSDAHLDDTA NIPSASTAEE ADAGSLLPTT 
       210        220        230        240        250
DEPSQALAGS DSLDSPPRSL ERSVSQLPSP PLLPTPPPKA SSKATKNVTG 
       260        270        280        290        300
QAALFQGPSM KNNEPALRGQ LATPTGSPHV TTVHRPLPPS RVMEELHRAL 
       310        320        330        340        350
ATKHRQDSFQ GRECRGSPKK RMDVRLSRTS SMERGKERDE AWSFDGASEN 
       360        370        380        390        400
KWTATKDSEE NKENLMLSSE LKDDMLLYQD EEALNDSIIS GTLPRKCKKE 
       410        420        430        440        450
LLAVKLRNRP SKQELEDRNI FPRRTDEERQ EIRQQIEMKL SKRLSQRPAV 
       460        470        480        490        500
EELERRNILK QRNDQTEQEE RREIKQRLTR KLNQRPTVDE LRDRKILIRF 
       510        520        530        540        550
SDYVEVARAQ DYDRRADKPW TRLSAADKAA IRKELNEYKS NEMEVHASSK 

HLTRFHRP
Length:558
Mass (Da):62,652
Last modified:November 28, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8D7D1D5F5BEE37A9
GO
Isoform 2 (identifier: Q8BYK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAASEDGSSC...ATSTDAGENP → MQTANQMLSL...PPGSGPSRCG

Show »
Length:559
Mass (Da):63,130
Checksum:i7A0191C5DB3A59CF
GO
Isoform 3 (identifier: Q8BYK5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MAASEDGSSCLVSRGRSQSDPSFLSDSSATSTDAGENP → MRGQGRGHARWPAPLRSLLRAFGPQDTTTGGLEQ

Show »
Length:554
Mass (Da):62,563
Checksum:iEE98DF913E41D1E0
GO
Isoform 4 (identifier: Q8BYK5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Show »
Length:518
Mass (Da):58,618
Checksum:iA1B24FD62E5DCD58
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AHM4A2AHM4_MOUSE
Phosphatase and actin regulator
Phactr3
553Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MPC1A0A5F8MPC1_MOUSE
Phosphatase and actin regulator
Phactr3
128Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0090951 – 40Missing in isoform 4. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_0090931 – 38MAASE…AGENP → MQTANQMLSLNFRRMKSGTA AVRTRARHRPPGSGPSRCG in isoform 2. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_0090941 – 38MAASE…AGENP → MRGQGRGHARWPAPLRSLLR AFGPQDTTTGGLEQ in isoform 3. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY501387 mRNA Translation: AAS86433.1
AK005136 mRNA Translation: BAB23834.1
AK032242 mRNA Translation: BAC27776.1
AK038449 mRNA Translation: BAC30003.1
AK039213 mRNA Translation: BAC30278.1
BC058621 mRNA Translation: AAH58621.1
BC059869 mRNA Translation: AAH59869.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS17158.1 [Q8BYK5-1]
CCDS17159.1 [Q8BYK5-4]
CCDS50837.1 [Q8BYK5-3]
CCDS50839.1 [Q8BYK5-2]

NCBI Reference Sequences

More...RefSeqi		NP_001007155.1, NM_001007154.3 [Q8BYK5-4]
NP_001171260.1, NM_001177789.1 [Q8BYK5-3]
NP_001171261.1, NM_001177790.1
NP_001171262.1, NM_001177791.1 [Q8BYK5-2]
NP_083082.1, NM_028806.2 [Q8BYK5-1]
XP_006500793.1, XM_006500730.2 [Q8BYK5-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000103065; ENSMUSP00000099354; ENSMUSG00000027525 [Q8BYK5-4]
ENSMUST00000103066; ENSMUSP00000099355; ENSMUSG00000027525 [Q8BYK5-1]
ENSMUST00000108915; ENSMUSP00000104543; ENSMUSG00000027525 [Q8BYK5-2]
ENSMUST00000108916; ENSMUSP00000104544; ENSMUSG00000027525 [Q8BYK5-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		74189

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:74189

UCSC genome browser

More...UCSCi		uc008ohj.2, mouse [Q8BYK5-3]
uc008ohk.2, mouse [Q8BYK5-1]
uc008ohl.2, mouse [Q8BYK5-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY501387 mRNA Translation: AAS86433.1
AK005136 mRNA Translation: BAB23834.1
AK032242 mRNA Translation: BAC27776.1
AK038449 mRNA Translation: BAC30003.1
AK039213 mRNA Translation: BAC30278.1
BC058621 mRNA Translation: AAH58621.1
BC059869 mRNA Translation: AAH59869.1
CCDSiCCDS17158.1 [Q8BYK5-1]
CCDS17159.1 [Q8BYK5-4]
CCDS50837.1 [Q8BYK5-3]
CCDS50839.1 [Q8BYK5-2]
RefSeqiNP_001007155.1, NM_001007154.3 [Q8BYK5-4]
NP_001171260.1, NM_001177789.1 [Q8BYK5-3]
NP_001171261.1, NM_001177790.1
NP_001171262.1, NM_001177791.1 [Q8BYK5-2]
NP_083082.1, NM_028806.2 [Q8BYK5-1]
XP_006500793.1, XM_006500730.2 [Q8BYK5-4]

3D structure databases

SMRiQ8BYK5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi216561, 2 interactors
STRINGi10090.ENSMUSP00000104543

PTM databases

iPTMnetiQ8BYK5
PhosphoSitePlusiQ8BYK5

Proteomic databases

PaxDbiQ8BYK5
PRIDEiQ8BYK5

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		29289, 111 antibodies

Genome annotation databases

EnsembliENSMUST00000103065; ENSMUSP00000099354; ENSMUSG00000027525 [Q8BYK5-4]
ENSMUST00000103066; ENSMUSP00000099355; ENSMUSG00000027525 [Q8BYK5-1]
ENSMUST00000108915; ENSMUSP00000104543; ENSMUSG00000027525 [Q8BYK5-2]
ENSMUST00000108916; ENSMUSP00000104544; ENSMUSG00000027525 [Q8BYK5-3]
GeneIDi74189
KEGGimmu:74189
UCSCiuc008ohj.2, mouse [Q8BYK5-3]
uc008ohk.2, mouse [Q8BYK5-1]
uc008ohl.2, mouse [Q8BYK5-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		116154
MGIiMGI:1921439, Phactr3

Phylogenomic databases

eggNOGiKOG4339, Eukaryota
GeneTreeiENSGT00940000157562
HOGENOMiCLU_015753_3_1_1
InParanoidiQ8BYK5
OMAiEDCVLQR
OrthoDBi1205245at2759
TreeFamiTF316316

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		74189, 0 hits in 17 CRISPR screens

Protein Ontology

More...PROi		PR:Q8BYK5
RNActiQ8BYK5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000027525, Expressed in lumbar subsegment of spinal cord and 150 other tissues
ExpressionAtlasiQ8BYK5, baseline and differential
GenevisibleiQ8BYK5, MM

Family and domain databases

InterProiView protein in InterPro
IPR029990, Phactr3
IPR004018, RPEL_repeat
PANTHERiPTHR12751:SF7, PTHR12751:SF7, 1 hit
PfamiView protein in Pfam
PF02755, RPEL, 1 hit
SMARTiView protein in SMART
SM00707, RPEL, 4 hits
PROSITEiView protein in PROSITE
PS51073, RPEL, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHAR3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BYK5
Secondary accession number(s): Q8BYS8, Q8C058, Q9DB87
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2003
Last sequence update: November 28, 2003
Last modified: December 2, 2020
This is version 126 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again