Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (12 Aug 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Leucine-rich repeat and fibronectin type-III domain-containing protein 5

Gene

Lrfn5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell adhesion molecule that mediates homophilic cell-cell adhesion in a Ca2+-independent manner. Promotes neurite outgrowth in hippocampal neurons (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leucine-rich repeat and fibronectin type-III domain-containing protein 5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Lrfn5
Synonyms:Kiaa4208, Salm5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2144814, Lrfn5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini18 – 529ExtracellularSequence analysisAdd BLAST512
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei530 – 550HelicalSequence analysisAdd BLAST21
Topological domaini551 – 719CytoplasmicSequence analysisAdd BLAST169

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001484618 – 719Leucine-rich repeat and fibronectin type-III domain-containing protein 5Add BLAST702

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi73N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi308 ↔ 357PROSITE-ProRule annotation
Glycosylationi330N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi339N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi382N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi452N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BXA0

PeptideAtlas

More...
PeptideAtlasi
Q8BXA0

PRoteomics IDEntifications database

More...
PRIDEi
Q8BXA0

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2424, 3 N-Linked glycans (1 site) [Q8BXA0-2]

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8BXA0, 6 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BXA0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BXA0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in the brain, with a weak, but broad expression in the cerebral cortex and diencephalic nuclei. Strongly expressed in both the pyramidal layer and the dentate gyrus of the hippocampus. Also detected in other parts of the central nervous system, including the olfactory bulb, pons, cerebellum, and medulla oblongata, as well as in the peripheral nervous system, such as the ganglia of cranial nerves and the dorsal root ganglion during gestation.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression starts around 11.5-12.5 dpc. At 11.5 dpc, detected in the outer layer of the telencephalic vesicles. This pattern of expression continues until 17.5 dpc with expression in the cortical plate, but not in the inner layer of the cerebral cortex, including subplate, ventricular zone, and subventricular zone. As also detected in the hippocampus, amygdala and widely in diencephalic nuclei.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000035653, Expressed in cortical plate and 141 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BXA0, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form heteromeric complexes with LRFN1, LRFN2, LRFN3 and LFRN4 (By similarity). Able to form homomeric complexes across cell junctions, between adjacent cells (By similarity). Does not interact with DLG1, DLG2 or DLG3 (By similarity). Does not interact with DLG4.

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000051546

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8BXA0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1719
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BXA0

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini18 – 51LRRNTAdd BLAST34
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati52 – 73LRR 1Add BLAST22
Repeati76 – 97LRR 2Add BLAST22
Repeati100 – 121LRR 3Add BLAST22
Repeati124 – 145LRR 4Add BLAST22
Repeati148 – 169LRR 5Add BLAST22
Repeati172 – 193LRR 6Add BLAST22
Repeati196 – 217LRR 7Add BLAST22
Domaini240 – 286LRRCTAdd BLAST47
Domaini287 – 373Ig-likeAdd BLAST87
Domaini414 – 503Fibronectin type-IIIAdd BLAST90

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Lacks a cytoplasmic PDZ-binding motif, which has been implicated in function of related LRFN proteins.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LRFN family.Curated

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0619, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158296

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_016998_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BXA0

KEGG Orthology (KO)

More...
KOi
K16358

Identification of Orthologs from Complete Genome Data

More...
OMAi
ETQNTNR

Database of Orthologous Groups

More...
OrthoDBi
151757at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BXA0

TreeFam database of animal gene trees

More...
TreeFami
TF350185

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 2 hits
3.80.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR001611, Leu-rich_rpt
IPR003591, Leu-rich_rpt_typical-subtyp
IPR026879, Lrfn5
IPR026906, LRR_5
IPR032675, LRR_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR45842:SF10, PTHR45842:SF10, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679, I-set, 1 hit
PF13306, LRR_5, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409, IG, 1 hit
SM00408, IGc2, 1 hit
SM00369, LRR_TYP, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 1 hit
SSF49265, SSF49265, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835, IG_LIKE, 1 hit
PS51450, LRR, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8BXA0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKFLFYLFL IGIAVRAQIC PKRCVCQILS PNLATLCAKK GLLFVPPNID
60 70 80 90 100
RRTVELRLAD NFVTNIKRKD FANMTSLVDL TLSRNTISFI TPHAFADLRN
110 120 130 140 150
LRALHLNSNR LTKITNDMFS GLSNLHHLIL NNNQLTLISS TAFDDVFALE
160 170 180 190 200
ELDLSYNNLE TIPWDAVEKM VSLHTLSLDH NMIDNIPKGT FSHLHKMTRL
210 220 230 240 250
DVTSNKLQKL PPDPLFQRAQ VLATSGIISP STFALSFGGN PLHCNCELLW
260 270 280 290 300
LRRLSREDDL ETCASPALLT GRYFWSIPEE EFLCEPPLIT RHTHEMRVLE
310 320 330 340 350
GQRATLRCKA RGDPEPAIHW ISPEGKLISN ATRSLVYDNG TLDILITTVK
360 370 380 390 400
DTGAFTCIAS NPAGEATQTV DLHIIKLPHL LNSTNHIHEP DPGSSDISTS
410 420 430 440 450
TKSGSNASSS NGDTKMSQDK IVVAEATSST ALLKFNFQRN IPGIRMFQIQ
460 470 480 490 500
YNGTYDDTLV YRMIPPTSKT FLVNNLASGT MYDLCVLAIY DDGITSLTAT
510 520 530 540 550
RVVGCIQFTT EQDYVRCHFM QSQFLGGTMI IIIGGIIVAS VLVFIIILMI
560 570 580 590 600
RYKVCNNNGQ HKVTKVSNVY SQTNGAQMQG CSVTLPQSMS KQAMGHEENA
610 620 630 640 650
QCCKVASDNA IQSSETCSSQ DSSTTTSALP PTWTSSAPVS QKQKRKTGTK
660 670 680 690 700
PSAEPQSEAV TNVESQNTNR NNSTALQLAS CPPDSVTEGP TSQRAHTKPN
710
ALLTNVDQNV QETQRLESI
Length:719
Mass (Da):79,371
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDCA5D8C68F7D6FEC
GO
Isoform 2 (identifier: Q8BXA0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     700-719: NALLTNVDQNVQETQRLESI → SKFLTVPAEGSRARHRASLSGGLKDSFHYGNSQLSLKRSMSMNAMWT

Note: Due to intron retention.Curated
Show »
Length:746
Mass (Da):82,286
Checksum:i00AA4767BA19908E
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD90535 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_009299700 – 719NALLT…RLESI → SKFLTVPAEGSRARHRASLS GGLKDSFHYGNSQLSLKRSM SMNAMWT in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK034245 mRNA Translation: BAC28645.1
AK048443 mRNA Translation: BAC33339.1
AK220546 mRNA Translation: BAD90535.1 Different initiation.
BC052038 mRNA Translation: AAH52038.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25936.1 [Q8BXA0-2]
CCDS79117.1 [Q8BXA0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001297515.1, NM_001310586.1 [Q8BXA0-1]
NP_848829.2, NM_178714.5 [Q8BXA0-2]
XP_006515893.1, XM_006515830.2 [Q8BXA0-2]
XP_006515894.1, XM_006515831.3 [Q8BXA0-2]
XP_017170545.1, XM_017315056.1 [Q8BXA0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000055815; ENSMUSP00000051546; ENSMUSG00000035653 [Q8BXA0-2]
ENSMUST00000119481; ENSMUSP00000113123; ENSMUSG00000035653 [Q8BXA0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
238205

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:238205

UCSC genome browser

More...
UCSCi
uc007nqm.1, mouse [Q8BXA0-2]
uc007nqn.1, mouse [Q8BXA0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034245 mRNA Translation: BAC28645.1
AK048443 mRNA Translation: BAC33339.1
AK220546 mRNA Translation: BAD90535.1 Different initiation.
BC052038 mRNA Translation: AAH52038.1
CCDSiCCDS25936.1 [Q8BXA0-2]
CCDS79117.1 [Q8BXA0-1]
RefSeqiNP_001297515.1, NM_001310586.1 [Q8BXA0-1]
NP_848829.2, NM_178714.5 [Q8BXA0-2]
XP_006515893.1, XM_006515830.2 [Q8BXA0-2]
XP_006515894.1, XM_006515831.3 [Q8BXA0-2]
XP_017170545.1, XM_017315056.1 [Q8BXA0-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6F2OX-ray3.00A18-376[»]
SMRiQ8BXA0
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000051546

PTM databases

GlyConnecti2424, 3 N-Linked glycans (1 site) [Q8BXA0-2]
GlyGeniQ8BXA0, 6 sites
iPTMnetiQ8BXA0
PhosphoSitePlusiQ8BXA0

Proteomic databases

PaxDbiQ8BXA0
PeptideAtlasiQ8BXA0
PRIDEiQ8BXA0

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
78, 71 antibodies

Genome annotation databases

EnsembliENSMUST00000055815; ENSMUSP00000051546; ENSMUSG00000035653 [Q8BXA0-2]
ENSMUST00000119481; ENSMUSP00000113123; ENSMUSG00000035653 [Q8BXA0-1]
GeneIDi238205
KEGGimmu:238205
UCSCiuc007nqm.1, mouse [Q8BXA0-2]
uc007nqn.1, mouse [Q8BXA0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
145581
MGIiMGI:2144814, Lrfn5

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG0619, Eukaryota
GeneTreeiENSGT00940000158296
HOGENOMiCLU_016998_0_0_1
InParanoidiQ8BXA0
KOiK16358
OMAiETQNTNR
OrthoDBi151757at2759
PhylomeDBiQ8BXA0
TreeFamiTF350185

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
238205, 1 hit in 13 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Lrfn5, mouse

Protein Ontology

More...
PROi
PR:Q8BXA0
RNActiQ8BXA0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000035653, Expressed in cortical plate and 141 other tissues
GenevisibleiQ8BXA0, MM

Family and domain databases

Gene3Di2.60.40.10, 2 hits
3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR001611, Leu-rich_rpt
IPR003591, Leu-rich_rpt_typical-subtyp
IPR026879, Lrfn5
IPR026906, LRR_5
IPR032675, LRR_dom_sf
PANTHERiPTHR45842:SF10, PTHR45842:SF10, 1 hit
PfamiView protein in Pfam
PF07679, I-set, 1 hit
PF13306, LRR_5, 1 hit
SMARTiView protein in SMART
SM00409, IG, 1 hit
SM00408, IGc2, 1 hit
SM00369, LRR_TYP, 6 hits
SUPFAMiSSF48726, SSF48726, 1 hit
SSF49265, SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit
PS51450, LRR, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLRFN5_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BXA0
Secondary accession number(s): Q5DTH4, Q8BJH4, Q8BZL0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: March 1, 2003
Last modified: August 12, 2020
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again