Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (08 May 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

N-alpha-acetyltransferase 25, NatB auxiliary subunit

Gene

Naa25

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp-Glu. May play a role in normal cell-cycle progression.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • N-terminal peptidyl-methionine acetylation Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
N-alpha-acetyltransferase 25, NatB auxiliary subunit
Alternative name(s):
Mitochondrial distribution and morphology protein 20
N-terminal acetyltransferase B complex subunit MDM20
Short name:
NatB complex subunit MDM20
N-terminal acetyltransferase B complex subunit NAA25
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Naa25
Synonyms:Mdm20
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2442563 Naa25

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002943381 – 972N-alpha-acetyltransferase 25, NatB auxiliary subunitAdd BLAST972

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8BWZ3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BWZ3

PeptideAtlas

More...
PeptideAtlasi
Q8BWZ3

PRoteomics IDEntifications database

More...
PRIDEi
Q8BWZ3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BWZ3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BWZ3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8BWZ3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000042719 Expressed in 247 organ(s), highest expression level in blastocyst

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BWZ3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BWZ3 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the N-terminal acetyltransferase B (NatB) complex which is composed of NAA20 and NAA25.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
231159, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q8BWZ3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000038977

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BWZ3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati11 – 44TPR 1Add BLAST34
Repeati45 – 78TPR 2Add BLAST34
Repeati79 – 112TPR 3Add BLAST34
Repeati114 – 146TPR 4Add BLAST33

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi871 – 877Poly-Lys7

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MDM20/NAA25 family.Curated

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2053 Eukaryota
ENOG410XRXD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183174

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060132

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BWZ3

KEGG Orthology (KO)

More...
KOi
K17973

Identification of Orthologs from Complete Genome Data

More...
OMAi
NSTSNFH

Database of Orthologous Groups

More...
OrthoDBi
1022953at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BWZ3

TreeFam database of animal gene trees

More...
TreeFami
TF315103

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019183 N-acetylTrfase_B_cplx_non-cat
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22767:SF3 PTHR22767:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09797 NatB_MDM20, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50293 TPR_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BWZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATRGHVQDP NDRRLRPIYD YLDNGNNKMA IQQADKLLKK HKDLHCAKVL
60 70 80 90 100
KAIGLQRTGK QEEAFTLAQE VAALEPTDDN SLQALTILYR EMHRPELVTK
110 120 130 140 150
LYEAAVKKVP NSEEYHSHLF MAYARVGEYK KMQQAGMALY KIVPKNPYYF
160 170 180 190 200
WSVMSLIMQS ISARDENLSK TMFLPLAERM VEKMVKEDKI EAEAEVELYY
210 220 230 240 250
MILERLGKYQ EALDVIRGKL GEKLTSEIQS RENKCMAMYK KLSKWPECNA
260 270 280 290 300
LSRRLLLKNS DDWQFYLTYF DSVFRLIEEA WTPPAEGEHS LEGEVHCSAE
310 320 330 340 350
DAVKFIEDRI TEASQSSRHV RGPHLAKLEL IRRLRSQGCN DEYKLGDPEE
360 370 380 390 400
LMFQYFKKFG DKPCCFTDLK VFVDLLPAAQ CTQFINQLLG VVPLSTPTED
410 420 430 440 450
KLALPADIRG LQQHLCVVQL TRLLGLYHSM DKSQKLDVVK ELMLRYQHGL
460 470 480 490 500
EFGRSCLKTE LQFSDYYCLL AVHVLIDVWR EAGEETAVWQ ALTLLEEGLT
510 520 530 540 550
HSPSNAQFKL LLVRIYCVLG AFEPVVDLYS SLDAKHIQHD TIGYLLTRYA
560 570 580 590 600
ASLGQYAAAS QSCNFALRFF HSNQKDTSEY IIQAYKYGAF EKIPEFIAFR
610 620 630 640 650
NRLNNSLHFA QVRTERMLLD LLLEANISIS LAESIKSMNL RPEEDDVPWE
660 670 680 690 700
DLRDNRDLDV FFSWDPKDRN VSEEHKKLSL EEETMWLRIR SLTLRLISGL
710 720 730 740 750
PSLTHPVEPK NSEKMSENGV SSRIDILRLL LQQLEVAVET GKRFIEKEIQ
760 770 780 790 800
YPFLGPVPTR MGRFFSSGCC QCQVQSFHLV SDMYELDTSG LEGTVDIQER
810 820 830 840 850
IENSLASLLE LLKGVFSTCK GDLLEVTDGN VKTQPAVLEN LVFFVETISV
860 870 880 890 900
ILWVSSYCES VLRPYKLNIQ KKKKKKKETS IIMPPIFTSF QDYVTGLQTV
910 920 930 940 950
ISNAVDHIKG LEAHLIALRL EELTLEETSI STEERKFSKT VQGKVQSSYL
960 970
HSLLETGELL RKRLETTKKL KI
Length:972
Mass (Da):111,708
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1393A5B38DE26D54
GO
Isoform 2 (identifier: Q8BWZ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAK → MCRTLTTGASGPFT

Show »
Length:938
Mass (Da):107,519
Checksum:i41F599FEC3179712
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6XQZ4F6XQZ4_MOUSE
N-alpha-acetyltransferase 25, NatB ...
Naa25
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UZ51G3UZ51_MOUSE
N-alpha-acetyltransferase 25, NatB ...
Naa25
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UZX9G3UZX9_MOUSE
N-alpha-acetyltransferase 25, NatB ...
Naa25
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti424L → I in BAE39569 (PubMed:16141072).Curated1
Sequence conflicti424L → I in BAE39494 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0266311 – 48MATRG…LHCAK → MCRTLTTGASGPFT in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK049325 mRNA Translation: BAC33684.1
AK149758 mRNA Translation: BAE29066.1
AK167405 mRNA Translation: BAE39494.1
AK167491 mRNA Translation: BAE39569.1
BC028868 mRNA Translation: AAH28868.1
BC055480 mRNA Translation: AAH55480.1
BC106182 mRNA Translation: AAI06183.1
BC132172 mRNA Translation: AAI32173.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19633.1 [Q8BWZ3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_766310.2, NM_172722.3 [Q8BWZ3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042163; ENSMUSP00000038977; ENSMUSG00000042719 [Q8BWZ3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
231713

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:231713

UCSC genome browser

More...
UCSCi
uc008zjb.1 mouse [Q8BWZ3-2]
uc008zjc.1 mouse [Q8BWZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049325 mRNA Translation: BAC33684.1
AK149758 mRNA Translation: BAE29066.1
AK167405 mRNA Translation: BAE39494.1
AK167491 mRNA Translation: BAE39569.1
BC028868 mRNA Translation: AAH28868.1
BC055480 mRNA Translation: AAH55480.1
BC106182 mRNA Translation: AAI06183.1
BC132172 mRNA Translation: AAI32173.1
CCDSiCCDS19633.1 [Q8BWZ3-1]
RefSeqiNP_766310.2, NM_172722.3 [Q8BWZ3-1]

3D structure databases

SMRiQ8BWZ3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231159, 1 interactor
IntActiQ8BWZ3, 1 interactor
STRINGi10090.ENSMUSP00000038977

PTM databases

iPTMnetiQ8BWZ3
PhosphoSitePlusiQ8BWZ3
SwissPalmiQ8BWZ3

Proteomic databases

EPDiQ8BWZ3
PaxDbiQ8BWZ3
PeptideAtlasiQ8BWZ3
PRIDEiQ8BWZ3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042163; ENSMUSP00000038977; ENSMUSG00000042719 [Q8BWZ3-1]
GeneIDi231713
KEGGimmu:231713
UCSCiuc008zjb.1 mouse [Q8BWZ3-2]
uc008zjc.1 mouse [Q8BWZ3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80018
MGIiMGI:2442563 Naa25

Phylogenomic databases

eggNOGiKOG2053 Eukaryota
ENOG410XRXD LUCA
GeneTreeiENSGT00950000183174
HOGENOMiHOG000060132
InParanoidiQ8BWZ3
KOiK17973
OMAiNSTSNFH
OrthoDBi1022953at2759
PhylomeDBiQ8BWZ3
TreeFamiTF315103

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8BWZ3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000042719 Expressed in 247 organ(s), highest expression level in blastocyst
ExpressionAtlasiQ8BWZ3 baseline and differential
GenevisibleiQ8BWZ3 MM

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR019183 N-acetylTrfase_B_cplx_non-cat
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR22767:SF3 PTHR22767:SF3, 1 hit
PfamiView protein in Pfam
PF09797 NatB_MDM20, 1 hit
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50293 TPR_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNAA25_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BWZ3
Secondary accession number(s): A1A4B7
, Q3KQI7, Q3TJC6, Q7TMM2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: May 8, 2019
This is version 126 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again