Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 106 (11 Dec 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc transporter ZIP11

Gene

Slc39a11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a cellular zinc transporter.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport, Zinc transport
LigandZinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc transporter ZIP11
Alternative name(s):
Solute carrier family 39 member 11
Zrt- and Irt-like protein 11
Short name:
ZIP-11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc39a11
Synonyms:Zip11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1917056 Slc39a11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei12 – 32HelicalSequence analysisAdd BLAST21
Transmembranei44 – 64HelicalSequence analysisAdd BLAST21
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Transmembranei194 – 214HelicalSequence analysisAdd BLAST21
Transmembranei263 – 285HelicalSequence analysisAdd BLAST23
Transmembranei290 – 307HelicalSequence analysisAdd BLAST18
Transmembranei322 – 342HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003084111 – 342Zinc transporter ZIP11Add BLAST342

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BWY7

PRoteomics IDEntifications database

More...
PRIDEi
Q8BWY7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BWY7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BWY7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the testes and portions of the digestive system including the stomach, ileum and cecum. In contrast, expressed at very low levels in liver, duodenum, jejunum, and colon.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during lactation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000041654 Expressed in 249 organ(s), highest expression level in dorsal pancreas

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BWY7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BWY7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8BWY7, 1 interactor

Molecular INTeraction database

More...
MINTi
Q8BWY7

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000102244

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8BWY7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2474 Eukaryota
COG0428 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006167

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232703

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BWY7

KEGG Orthology (KO)

More...
KOi
K14717

Identification of Orthologs from Complete Genome Data

More...
OMAi
MIYVVVE

Database of Orthologous Groups

More...
OrthoDBi
892454at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BWY7

TreeFam database of animal gene trees

More...
TreeFami
TF105905

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003689 ZIP

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02535 Zip, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BWY7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQGYSSVVQ ALLGTFFTWA MTAAGAALVF IFSSGQRRIL DGSLGFAAGV
60 70 80 90 100
MLAASYWSLL APAVEMATSS GGFGAFAFFP VAVGFTLGAA FVYLADLLMP
110 120 130 140 150
HLGATEDPQT ALALNLDPAL MKKSDPRDPT SLLFPESELS IRIGSTGLLS
160 170 180 190 200
DKRENGEVYQ RKKVAATDLA EGVAPSGSMH GSSGQPGGSS WRRIALLILA
210 220 230 240 250
ITIHNIPEGL AVGVGFGAVE KTASATFESA RNLAIGIGIQ NFPEGLAVSL
260 270 280 290 300
PLRGAGFSTW KAFWYGQLSG MVEPLAGVFG AFAVVLAEPI LPYALAFAAG
310 320 330 340
AMVYVVMDDI IPEAQISGNG KLASWASILG FVVMMSLDVG LG
Length:342
Mass (Da):35,466
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3A5F4517D0D5652D
GO
Isoform 2 (identifier: Q8BWY7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-102: L → LLQVSFLPSGDCKMPTATKTPLLGRTRAVELLGGNQ
     144-150: Missing.

Show »
Length:370
Mass (Da):38,533
Checksum:i090460A70783A6F8
GO
Isoform 3 (identifier: Q8BWY7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-150: Missing.

Show »
Length:335
Mass (Da):34,850
Checksum:i776409F723481B9E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1ARC2B1ARC2_MOUSE
Zinc transporter ZIP11
Slc39a11
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1ARC4B1ARC4_MOUSE
Zinc transporter ZIP11
Slc39a11
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1ARC5B1ARC5_MOUSE
Zinc transporter ZIP11
Slc39a11
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1ARC3B1ARC3_MOUSE
Zinc transporter ZIP11
Slc39a11
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH04643 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence AAH04643 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22T → S in AAH19647 (PubMed:15489334).Curated1
Sequence conflicti49G → V in BAC29664 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028977102L → LLQVSFLPSGDCKMPTATKT PLLGRTRAVELLGGNQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_028978144 – 150Missing in isoform 2 and isoform 3. 2 Publications7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK007986 mRNA Translation: BAB25390.1
AK036999 mRNA Translation: BAC29664.1
AK049368 mRNA Translation: BAC33713.1
AK170673 mRNA Translation: BAE41950.1
AL596104 Genomic DNA No translation available.
AL603705 Genomic DNA No translation available.
AL604025 Genomic DNA No translation available.
BC004643 mRNA Translation: AAH04643.1 Different initiation.
BC019647 mRNA Translation: AAH19647.1
BC031751 mRNA Translation: AAH31751.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36363.1 [Q8BWY7-3]
CCDS48975.1 [Q8BWY7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001159975.1, NM_001166503.1 [Q8BWY7-1]
NP_081492.4, NM_027216.5 [Q8BWY7-3]
XP_006534190.1, XM_006534127.3
XP_006534193.1, XM_006534130.3 [Q8BWY7-1]
XP_006534197.1, XM_006534134.3
XP_011247533.1, XM_011249231.1 [Q8BWY7-1]
XP_011247534.1, XM_011249232.1
XP_017170232.1, XM_017314743.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042657; ENSMUSP00000037331; ENSMUSG00000041654 [Q8BWY7-2]
ENSMUST00000071539; ENSMUSP00000071469; ENSMUSG00000041654 [Q8BWY7-3]
ENSMUST00000106633; ENSMUSP00000102244; ENSMUSG00000041654 [Q8BWY7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
69806

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:69806

UCSC genome browser

More...
UCSCi
uc007mem.2 mouse [Q8BWY7-3]
uc007men.2 mouse [Q8BWY7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007986 mRNA Translation: BAB25390.1
AK036999 mRNA Translation: BAC29664.1
AK049368 mRNA Translation: BAC33713.1
AK170673 mRNA Translation: BAE41950.1
AL596104 Genomic DNA No translation available.
AL603705 Genomic DNA No translation available.
AL604025 Genomic DNA No translation available.
BC004643 mRNA Translation: AAH04643.1 Different initiation.
BC019647 mRNA Translation: AAH19647.1
BC031751 mRNA Translation: AAH31751.1
CCDSiCCDS36363.1 [Q8BWY7-3]
CCDS48975.1 [Q8BWY7-1]
RefSeqiNP_001159975.1, NM_001166503.1 [Q8BWY7-1]
NP_081492.4, NM_027216.5 [Q8BWY7-3]
XP_006534190.1, XM_006534127.3
XP_006534193.1, XM_006534130.3 [Q8BWY7-1]
XP_006534197.1, XM_006534134.3
XP_011247533.1, XM_011249231.1 [Q8BWY7-1]
XP_011247534.1, XM_011249232.1
XP_017170232.1, XM_017314743.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ8BWY7, 1 interactor
MINTiQ8BWY7
STRINGi10090.ENSMUSP00000102244

PTM databases

iPTMnetiQ8BWY7
PhosphoSitePlusiQ8BWY7

Proteomic databases

PaxDbiQ8BWY7
PRIDEiQ8BWY7

Genome annotation databases

EnsembliENSMUST00000042657; ENSMUSP00000037331; ENSMUSG00000041654 [Q8BWY7-2]
ENSMUST00000071539; ENSMUSP00000071469; ENSMUSG00000041654 [Q8BWY7-3]
ENSMUST00000106633; ENSMUSP00000102244; ENSMUSG00000041654 [Q8BWY7-1]
GeneIDi69806
KEGGimmu:69806
UCSCiuc007mem.2 mouse [Q8BWY7-3]
uc007men.2 mouse [Q8BWY7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
201266
MGIiMGI:1917056 Slc39a11

Phylogenomic databases

eggNOGiKOG2474 Eukaryota
COG0428 LUCA
GeneTreeiENSGT00390000006167
HOGENOMiHOG000232703
InParanoidiQ8BWY7
KOiK14717
OMAiMIYVVVE
OrthoDBi892454at2759
PhylomeDBiQ8BWY7
TreeFamiTF105905

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc39a11 mouse

Protein Ontology

More...
PROi
PR:Q8BWY7
RNActiQ8BWY7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000041654 Expressed in 249 organ(s), highest expression level in dorsal pancreas
ExpressionAtlasiQ8BWY7 baseline and differential
GenevisibleiQ8BWY7 MM

Family and domain databases

InterProiView protein in InterPro
IPR003689 ZIP
PfamiView protein in Pfam
PF02535 Zip, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS39AB_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BWY7
Secondary accession number(s): Q8BZ08
, Q8K0E0, Q8VE72, Q99KI2, Q9D8J0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 1, 2003
Last modified: December 11, 2019
This is version 106 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again