Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8BWL5 (RBMS3_MOUSE)

Entry version 126 (02 Dec 2020)
Sequence version 2 (06 Feb 2007)
Previous versions | rss
Add a publicationFeedback
Protein

RNA-binding motif, single-stranded-interacting protein 3

Gene

Rbms3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds poly(A) and poly(U) oligoribonucleotides.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RNA-binding motif, single-stranded-interacting protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rbms3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2444477, Rbms3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002749071 – 431RNA-binding motif, single-stranded-interacting protein 3Add BLAST431

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8BWL5

PRoteomics IDEntifications database

More...PRIDEi		Q8BWL5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8BWL5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8BWL5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000039607, Expressed in vas deferens and 249 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8BWL5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8BWL5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000107403

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8BWL5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8BWL5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini56 – 129RRM 1PROSITE-ProRule annotationAdd BLAST74
Domaini135 – 220RRM 2PROSITE-ProRule annotationAdd BLAST86

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4733, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157131

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_016278_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8BWL5

Identification of Orthologs from Complete Genome Data

More...OMAi		HYLQTKX

Database of Orthologous Groups

More...OrthoDBi		810893at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8BWL5

TreeFam database of animal gene trees

More...TreeFami		TF314644

Family and domain databases

Conserved Domains Database

More...CDDi		cd12475, RRM2_RBMS3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.330, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002343, Hud_Sxl_RNA
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR034406, RBMS3_RRM2
IPR000504, RRM_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00076, RRM_1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00961, HUDSXLRNA

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360, RRM, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928, SSF54928, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50102, RRM, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BWL5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKRLDQPQM YPQYTYYCPQ YLQTKQSYAP APHPMAPPSP STNSSSNSSG 
        60         70         80         90        100
EQLSKTNLYI RGLPPGTTDQ DLIKLCQPYG KIVSTKAILD KNTNQCKGYG 
       110        120        130        140        150
FVDFDSPAAA QKAVASLKAN GVQAQMAKQQ EQDPTNLYIS NLPISMDEQE 
       160        170        180        190        200
LENMLKPFGH VISTRILRDA NGVSRGVGFA RMESTEKCEV VIQHFNGKYL 
       210        220        230        240        250
KTPPGIPAPS EPLLCKFADG GQKKRQGQSK HTQNGRPWPR EGEAGMALTY 
       260        270        280        290        300
DPTAALQNGF YSSPYSLATN RMIPQTSITP FIAASPVSTY QVQSTSWTPH 
       310        320        330        340        350
LPYIMQPTGA VITPAVDHPM SMQPTNIVGP LTQQMNHLSL GTAGTIQSQD 
       360        370        380        390        400
RIMVLHQLLC QYMTAAPMQG TYIPQYTPVP PTAVSIEGVV ADTSPQTVAP 
       410        420        430 
SSQDSSGQQQ QLAVDTPSEH APAYSFQQSK P
Length:431
Mass (Da):46,927
Last modified:February 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65D096613FDF783A
GO
Isoform 2 (identifier: Q8BWL5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-361: Missing.

Show »
Length:415
Mass (Da):45,020
Checksum:i58C0229A95698D24
GO
Isoform 3 (identifier: Q8BWL5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     292-308: Missing.

Show »
Length:414
Mass (Da):44,959
Checksum:i5EC4B16CBE0A3A1A
GO
Isoform 4 (identifier: Q8BWL5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-361: Missing.
     388-431: GVVADTSPQTVAPSSQDSSGQQQQLAVDTPSEHAPAYSFQQSKP → TIDRSEDVCLNLYLQ

Show »
Length:386
Mass (Da):42,244
Checksum:iFFF527486383B871
GO
Isoform 5 (identifier: Q8BWL5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MGKRLDQPQMYPQYTYYCPQYLQTKQ → MEGGRLLIRS...SYTYCTGHPV
     292-308: Missing.

Show »
Length:463
Mass (Da):50,004
Checksum:i7AD6BA9A8BA0D5AF
GO
Isoform 6 (identifier: Q8BWL5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-431: GVVADTSPQTVAPSSQDSSGQQQQLAVDTPSEHAPAYSFQQSKP → TIDRSEDVCLNLYLQ

Show »
Length:402
Mass (Da):44,151
Checksum:i2817B4A05DBF50A4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A6I8MX12A0A6I8MX12_MOUSE
RNA-binding motif, single-stranded-...
Rbms3
541Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UZJ9G3UZJ9_MOUSE
RNA-binding motif, single-stranded-...
Rbms3
206Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UY10G3UY10_MOUSE
RNA-binding motif, single-stranded-...
Rbms3
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UYP9G3UYP9_MOUSE
RNA-binding motif, single-stranded-...
Rbms3
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC34878 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10M → I in BAC26980 (PubMed:16141072).Curated1
Sequence conflicti20Q → H in BAC26980 (PubMed:16141072).Curated1
Sequence conflicti309G → S in AAI08403 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0229321 – 26MGKRL…LQTKQ → MEGGRLLIRSNANGVTQSNS TVRAYQSSKSRVTMSPGFSS QWSNSQPAWNTYSFPRASLH YQSHASYTYCTGHPV in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_022933292 – 308Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_022934346 – 361Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_022935388 – 431GVVAD…QQSKP → TIDRSEDVCLNLYLQ in isoform 4 and isoform 6. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK030478 mRNA Translation: BAC26980.1
AK030609 mRNA Translation: BAC27045.1
AK032938 mRNA Translation: BAC28091.1
AK033005 mRNA Translation: BAC28122.1
AK041098 mRNA Translation: BAC30820.1
AK046197 mRNA Translation: BAC32633.1
AK052196 mRNA Translation: BAC34878.1 Different initiation.
BC108402 mRNA Translation: AAI08403.1
BC117841 mRNA Translation: AAI17842.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS40798.1 [Q8BWL5-3]
CCDS52955.1 [Q8BWL5-2]
CCDS52956.1 [Q8BWL5-6]
CCDS52957.1 [Q8BWL5-1]
CCDS57711.1 [Q8BWL5-4]
CCDS57712.1 [Q8BWL5-5]

NCBI Reference Sequences

More...RefSeqi		NP_001165592.1, NM_001172121.1 [Q8BWL5-5]
NP_001165593.1, NM_001172122.1 [Q8BWL5-2]
NP_001165594.1, NM_001172123.1 [Q8BWL5-1]
NP_001165595.1, NM_001172124.1 [Q8BWL5-6]
NP_001165597.1, NM_001172126.1 [Q8BWL5-4]
NP_848775.2, NM_178660.4 [Q8BWL5-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000044901; ENSMUSP00000039706; ENSMUSG00000039607 [Q8BWL5-4]
ENSMUST00000068962; ENSMUSP00000066735; ENSMUSG00000039607 [Q8BWL5-3]
ENSMUST00000111772; ENSMUSP00000107402; ENSMUSG00000039607 [Q8BWL5-2]
ENSMUST00000111773; ENSMUSP00000107403; ENSMUSG00000039607 [Q8BWL5-1]
ENSMUST00000164018; ENSMUSP00000131371; ENSMUSG00000039607 [Q8BWL5-5]
ENSMUST00000174868; ENSMUSP00000133621; ENSMUSG00000039607 [Q8BWL5-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		207181

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:207181

UCSC genome browser

More...UCSCi		uc009ryv.3, mouse [Q8BWL5-3]
uc009ryw.3, mouse [Q8BWL5-1]
uc009ryx.3, mouse [Q8BWL5-2]
uc009ryy.3, mouse [Q8BWL5-6]
uc009ryz.3, mouse [Q8BWL5-4]
uc009rza.3, mouse [Q8BWL5-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK030478 mRNA Translation: BAC26980.1
AK030609 mRNA Translation: BAC27045.1
AK032938 mRNA Translation: BAC28091.1
AK033005 mRNA Translation: BAC28122.1
AK041098 mRNA Translation: BAC30820.1
AK046197 mRNA Translation: BAC32633.1
AK052196 mRNA Translation: BAC34878.1 Different initiation.
BC108402 mRNA Translation: AAI08403.1
BC117841 mRNA Translation: AAI17842.1
CCDSiCCDS40798.1 [Q8BWL5-3]
CCDS52955.1 [Q8BWL5-2]
CCDS52956.1 [Q8BWL5-6]
CCDS52957.1 [Q8BWL5-1]
CCDS57711.1 [Q8BWL5-4]
CCDS57712.1 [Q8BWL5-5]
RefSeqiNP_001165592.1, NM_001172121.1 [Q8BWL5-5]
NP_001165593.1, NM_001172122.1 [Q8BWL5-2]
NP_001165594.1, NM_001172123.1 [Q8BWL5-1]
NP_001165595.1, NM_001172124.1 [Q8BWL5-6]
NP_001165597.1, NM_001172126.1 [Q8BWL5-4]
NP_848775.2, NM_178660.4 [Q8BWL5-3]

3D structure databases

SMRiQ8BWL5
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000107403

PTM databases

iPTMnetiQ8BWL5
PhosphoSitePlusiQ8BWL5

Proteomic databases

PaxDbiQ8BWL5
PRIDEiQ8BWL5

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		11544, 166 antibodies

Genome annotation databases

EnsembliENSMUST00000044901; ENSMUSP00000039706; ENSMUSG00000039607 [Q8BWL5-4]
ENSMUST00000068962; ENSMUSP00000066735; ENSMUSG00000039607 [Q8BWL5-3]
ENSMUST00000111772; ENSMUSP00000107402; ENSMUSG00000039607 [Q8BWL5-2]
ENSMUST00000111773; ENSMUSP00000107403; ENSMUSG00000039607 [Q8BWL5-1]
ENSMUST00000164018; ENSMUSP00000131371; ENSMUSG00000039607 [Q8BWL5-5]
ENSMUST00000174868; ENSMUSP00000133621; ENSMUSG00000039607 [Q8BWL5-6]
GeneIDi207181
KEGGimmu:207181
UCSCiuc009ryv.3, mouse [Q8BWL5-3]
uc009ryw.3, mouse [Q8BWL5-1]
uc009ryx.3, mouse [Q8BWL5-2]
uc009ryy.3, mouse [Q8BWL5-6]
uc009ryz.3, mouse [Q8BWL5-4]
uc009rza.3, mouse [Q8BWL5-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		27303
MGIiMGI:2444477, Rbms3

Phylogenomic databases

eggNOGiKOG4733, Eukaryota
GeneTreeiENSGT00940000157131
HOGENOMiCLU_016278_2_0_1
InParanoidiQ8BWL5
OMAiHYLQTKX
OrthoDBi810893at2759
PhylomeDBiQ8BWL5
TreeFamiTF314644

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		207181, 4 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Rbms3, mouse

Protein Ontology

More...PROi		PR:Q8BWL5
RNActiQ8BWL5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000039607, Expressed in vas deferens and 249 other tissues
ExpressionAtlasiQ8BWL5, baseline and differential
GenevisibleiQ8BWL5, MM

Family and domain databases

CDDicd12475, RRM2_RBMS3, 1 hit
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR002343, Hud_Sxl_RNA
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR034406, RBMS3_RRM2
IPR000504, RRM_dom
PfamiView protein in Pfam
PF00076, RRM_1, 2 hits
PRINTSiPR00961, HUDSXLRNA
SMARTiView protein in SMART
SM00360, RRM, 2 hits
SUPFAMiSSF54928, SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102, RRM, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBMS3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BWL5
Secondary accession number(s): Q2VPR0
, Q8BL73, Q8BLW6, Q8BMA7, Q8BMB5, Q8BML0, Q8BMN1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: December 2, 2020
This is version 126 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again