Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein NDRG4

Gene

Ndrg4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.1 Publication

GO - Biological processi

Protein family/group databases

ESTHERimouse-ndr4 Ndr_family
MEROPSiS33.986

Names & Taxonomyi

Protein namesi
Recommended name:
Protein NDRG4
Alternative name(s):
N-myc downstream-regulated gene 4 protein
Protein Ndr4
Gene namesi
Name:Ndrg4
Synonyms:Kiaa1180, Ndr4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2384590 Ndrg4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

Mutant mice have impaired spatial learning and memory but normal motor function.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001595801 – 352Protein NDRG4Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei298PhosphoserineBy similarity1
Modified residuei317PhosphoserineBy similarity1
Modified residuei323PhosphoserineCombined sources1
Isoform 2 (identifier: Q8BTG7-2)
Modified residuei293PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BTG7
PeptideAtlasiQ8BTG7
PRIDEiQ8BTG7

PTM databases

iPTMnetiQ8BTG7
PhosphoSitePlusiQ8BTG7

Expressioni

Tissue specificityi

Predominantly expressed in the brain (at protein level). Detected in neurons of various parts of brain, including the olfactory bulb, olfactory tuberculum, cerebral cortex, striatum, hippocampus, dentate gyrus, thalamus, hypothalamus, mesencephalon, cerebellum, pons and medulla oblongata.1 Publication

Gene expression databases

BgeeiENSMUSG00000036564 Expressed in 297 organ(s), highest expression level in olfactory tubercle
CleanExiMM_NDRG4
ExpressionAtlasiQ8BTG7 baseline and differential
GenevisibleiQ8BTG7 MM

Interactioni

Protein-protein interaction databases

IntActiQ8BTG7, 1 interactor
MINTiQ8BTG7
STRINGi10090.ENSMUSP00000072883

Structurei

3D structure databases

ProteinModelPortaliQ8BTG7
SMRiQ8BTG7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi253 – 256Poly-Thr4

Sequence similaritiesi

Belongs to the NDRG family.Curated

Phylogenomic databases

eggNOGiKOG2931 Eukaryota
ENOG410XSPF LUCA
GeneTreeiENSGT00390000001874
HOGENOMiHOG000230891
HOVERGENiHBG052591
InParanoidiQ8BTG7
OMAiFFNYEDM
OrthoDBiEOG091G09VW
PhylomeDBiQ8BTG7
TreeFamiTF313168

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR004142 NDRG
IPR030695 NDRG4
PANTHERiPTHR11034 PTHR11034, 1 hit
PTHR11034:SF21 PTHR11034:SF21, 1 hit
PfamiView protein in Pfam
PF03096 Ndr, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BTG7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPECWDGEHD IETPYGLLHV VIRGSPKGNR PAILTYHDVG LNHKLCFNTF
60 70 80 90 100
FNFEDMQEIT KHFVVCHVDA PGQQVGASQF PQGYQFPSME QLAAMLPSVV
110 120 130 140 150
QHFGFKYVIG IGVGAGAYVL AKFALIFPDL VEGLVLMNID PNGKGWIDWA
160 170 180 190 200
ATKLSGLTST LPDTVLSHLF SQEELVNNTE LVQSYRQQIS NVVNQANLQL
210 220 230 240 250
FWNMYNSRRD LDINRPGTVP NAKTLRCPVM LVVGDNAPAE EGVVECNSKL
260 270 280 290 300
DPTTTTFLKM ADSGGLPQVT QPGKLTEAFK YFLQGMGYIA HLKDRRLSGG
310 320 330 340 350
AVPSASMTRL ARSRTASLTS ASSVDGSRPQ PCAHSDSSEG MGQVNHTMEV

SC
Length:352
Mass (Da):38,509
Last modified:March 1, 2003 - v1
Checksum:i3ED388148DC852CD
GO
Isoform 2 (identifier: Q8BTG7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     289-302: IAHLKDRRLSGGAV → M

Show »
Length:339
Mass (Da):37,165
Checksum:i4FE9617B206700A2
GO
Isoform 3 (identifier: Q8BTG7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPECWDG → MKVLGHRLQLLTGLLLHDVTMAGLQELRFPEEKPLLRGQDATEMDNPDAFLSIVDTDWK

Show »
Length:404
Mass (Da):44,390
Checksum:i82668DC8A956EEDB
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q168E9Q168_MOUSE
Protein NDRG4
Ndrg4
81Annotation score:
E0CZ50E0CZ50_MOUSE
Protein NDRG4
Ndrg4
224Annotation score:
A0A1D5RMH3A0A1D5RMH3_MOUSE
Protein NDRG4
Ndrg4
197Annotation score:
A0A1D5RM17A0A1D5RM17_MOUSE
Protein NDRG4
Ndrg4
109Annotation score:
A0A1D5RM37A0A1D5RM37_MOUSE
Protein NDRG4
Ndrg4
51Annotation score:

Sequence cautioni

The sequence BAC98115 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0229581 – 7MPECWDG → MKVLGHRLQLLTGLLLHDVT MAGLQELRFPEEKPLLRGQD ATEMDNPDAFLSIVDTDWK in isoform 3. 1 Publication7
Alternative sequenceiVSP_022959289 – 302IAHLK…SGGAV → M in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090374 mRNA Translation: BAC41189.1
AK168873 mRNA Translation: BAE40691.1
AK129305 mRNA Translation: BAC98115.1 Different initiation.
BC006595 mRNA Translation: AAH06595.1
CCDSiCCDS22565.1 [Q8BTG7-2]
CCDS57634.1 [Q8BTG7-1]
RefSeqiNP_001181935.1, NM_001195006.1 [Q8BTG7-1]
NP_663577.1, NM_145602.3 [Q8BTG7-2]
XP_006530930.1, XM_006530867.1 [Q8BTG7-3]
UniGeneiMm.29846

Genome annotation databases

EnsembliENSMUST00000041318; ENSMUSP00000036226; ENSMUSG00000036564 [Q8BTG7-3]
ENSMUST00000073139; ENSMUSP00000072883; ENSMUSG00000036564 [Q8BTG7-1]
ENSMUST00000080666; ENSMUSP00000079495; ENSMUSG00000036564 [Q8BTG7-2]
GeneIDi234593
KEGGimmu:234593
UCSCiuc009mys.2 mouse [Q8BTG7-3]
uc009myt.2 mouse [Q8BTG7-2]
uc009myu.2 mouse [Q8BTG7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK090374 mRNA Translation: BAC41189.1
AK168873 mRNA Translation: BAE40691.1
AK129305 mRNA Translation: BAC98115.1 Different initiation.
BC006595 mRNA Translation: AAH06595.1
CCDSiCCDS22565.1 [Q8BTG7-2]
CCDS57634.1 [Q8BTG7-1]
RefSeqiNP_001181935.1, NM_001195006.1 [Q8BTG7-1]
NP_663577.1, NM_145602.3 [Q8BTG7-2]
XP_006530930.1, XM_006530867.1 [Q8BTG7-3]
UniGeneiMm.29846

3D structure databases

ProteinModelPortaliQ8BTG7
SMRiQ8BTG7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BTG7, 1 interactor
MINTiQ8BTG7
STRINGi10090.ENSMUSP00000072883

Protein family/group databases

ESTHERimouse-ndr4 Ndr_family
MEROPSiS33.986

PTM databases

iPTMnetiQ8BTG7
PhosphoSitePlusiQ8BTG7

Proteomic databases

PaxDbiQ8BTG7
PeptideAtlasiQ8BTG7
PRIDEiQ8BTG7

Protocols and materials databases

DNASUi234593
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041318; ENSMUSP00000036226; ENSMUSG00000036564 [Q8BTG7-3]
ENSMUST00000073139; ENSMUSP00000072883; ENSMUSG00000036564 [Q8BTG7-1]
ENSMUST00000080666; ENSMUSP00000079495; ENSMUSG00000036564 [Q8BTG7-2]
GeneIDi234593
KEGGimmu:234593
UCSCiuc009mys.2 mouse [Q8BTG7-3]
uc009myt.2 mouse [Q8BTG7-2]
uc009myu.2 mouse [Q8BTG7-1]

Organism-specific databases

CTDi65009
MGIiMGI:2384590 Ndrg4
RougeiSearch...

Phylogenomic databases

eggNOGiKOG2931 Eukaryota
ENOG410XSPF LUCA
GeneTreeiENSGT00390000001874
HOGENOMiHOG000230891
HOVERGENiHBG052591
InParanoidiQ8BTG7
OMAiFFNYEDM
OrthoDBiEOG091G09VW
PhylomeDBiQ8BTG7
TreeFamiTF313168

Miscellaneous databases

ChiTaRSiNdrg4 mouse
PROiPR:Q8BTG7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036564 Expressed in 297 organ(s), highest expression level in olfactory tubercle
CleanExiMM_NDRG4
ExpressionAtlasiQ8BTG7 baseline and differential
GenevisibleiQ8BTG7 MM

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR004142 NDRG
IPR030695 NDRG4
PANTHERiPTHR11034 PTHR11034, 1 hit
PTHR11034:SF21 PTHR11034:SF21, 1 hit
PfamiView protein in Pfam
PF03096 Ndr, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNDRG4_MOUSE
AccessioniPrimary (citable) accession number: Q8BTG7
Secondary accession number(s): Q6ZPW3, Q923D7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: March 1, 2003
Last modified: September 12, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again