Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CCR4-NOT transcription complex subunit 4

Gene

Cnot4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has E3 ubiquitin ligase activity, promoting ubiquitination and degradation of target proteins. Involved in activation of the JAK/STAT pathway. Catalyzes ubiquitination of methylated RBM15.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.By similarity
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri14 – 57RING-type; degeneratePROSITE-ProRule annotationAdd BLAST44
Zinc fingeri190 – 217C3H1-typePROSITE-ProRule annotationAdd BLAST28

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding, Transferase
Biological processTranscription, Transcription regulation, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 4 (EC:2.3.2.27By similarity)
Alternative name(s):
CCR4-associated factor 4
E3 ubiquitin-protein ligase CNOT4
Potential transcriptional repressor NOT4Hp
RING-type E3 ubiquitin transferase CNOT4Curated
Gene namesi
Name:Cnot4
Synonyms:Not4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1859026 Cnot4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000816801 – 575CCR4-NOT transcription complex subunit 4Add BLAST575

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei71PhosphoserineCombined sources1
Modified residuei301PhosphoserineBy similarity1
Modified residuei324PhosphoserineCombined sources1
Modified residuei432PhosphoserineBy similarity1
Modified residuei475Asymmetric dimethylarginineCombined sources1
Modified residuei483Asymmetric dimethylarginineBy similarity1
Modified residuei497Asymmetric dimethylarginineCombined sources1
Isoform 2 (identifier: Q8BT14-2)
Modified residuei296PhosphothreonineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei304PhosphoserineCombined sources1

Post-translational modificationi

Autoubiquitinated.By similarity

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ8BT14
PRIDEiQ8BT14

PTM databases

iPTMnetiQ8BT14
PhosphoSitePlusiQ8BT14

Expressioni

Gene expression databases

BgeeiENSMUSG00000038784 Expressed in 286 organ(s), highest expression level in skin of back
CleanExiMM_CNOT4
ExpressionAtlasiQ8BT14 baseline and differential
GenevisibleiQ8BT14 MM

Interactioni

Subunit structurei

Interacts with CNOT1 via its C-terminus but does not stably associate with the CCR4-NOT complex. Binds E2 ubiquitin ligases via its RING domain. Interacts (via RING domain) with UBE2D2.By similarity

Protein-protein interaction databases

IntActiQ8BT14, 2 interactors
STRINGi10090.ENSMUSP00000110645

Structurei

Secondary structure

1575
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8BT14
SMRiQ8BT14
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8BT14

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini109 – 189RRMPROSITE-ProRule annotationAdd BLAST81

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili68 – 104Sequence analysisAdd BLAST37

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri14 – 57RING-type; degeneratePROSITE-ProRule annotationAdd BLAST44
Zinc fingeri190 – 217C3H1-typePROSITE-ProRule annotationAdd BLAST28

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG2068 Eukaryota
COG5175 LUCA
GeneTreeiENSGT00390000000068
HOGENOMiHOG000065696
HOVERGENiHBG051043
InParanoidiQ8BT14
KOiK10643
PhylomeDBiQ8BT14
TreeFamiTF106134

Family and domain databases

CDDicd16618 mRING-HC-C4C4_CNOT4, 1 hit
cd12438 RRM_CNOT4, 1 hit
Gene3Di3.30.40.10, 1 hit
3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR034261 CNOT4_RRM
IPR039780 Mot2
IPR039515 NOT4_mRING-HC-C4C4
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR003954 RRM_dom_euk
IPR000571 Znf_CCCH
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR12603 PTHR12603, 2 hits
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00361 RRM_1, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50103 ZF_C3H1, 1 hit
PS50089 ZF_RING_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BT14-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRSPDAKED PVECPLCMEP LEIDDINFFP CTCGYQICRF CWHRIRTDEN
60 70 80 90 100
GLCPACRKPY PEDPAVYKPL SQEELQRIKN EKKQKQNERK QKISENRKHL
110 120 130 140 150
ASVRVVQKNL VFVVGLSQRL ADPEVLKRPE YFGKFGKIHK VVINNSTSYA
160 170 180 190 200
GSQGPSASAY VTYIRSEDAL RAIQCVNNVV VDGRTLKASL GTTKYCSYFL
210 220 230 240 250
KNMQCPKPDC MYLHELGDEA ASFTKEEMQA GKHQEYEQKL LQELYKLNPN
260 270 280 290 300
FLQLSTGSVD KNKNKVTPLQ RYDTPIDKPS DSLSIGNGDN SQQISNSDTP
310 320 330 340 350
SPPPGLSKSN PVIPISSSNH SARSPFEGAV TESQSLFSDN FRHPNPIPSG
360 370 380 390 400
LPPFPSSPQT PSDWPTAPEP QSLFTSETIP VSSSTDWQAA FGFGSSKQPE
410 420 430 440 450
DDLGFDPFDV TRKALADLIE KELSVQDQPS LSPTSLQNAS SHTTTAKGPG
460 470 480 490 500
SGFLHSAAPT NANSLNSTFS VLPQRFPQFQ QHRAVYNSFG FPGQAARYPW
510 520 530 540 550
MAFPRNSIMH LNHTANPTSN SNFLDLNLPP QHNTGLGGIP IAGEEEVKVS
560 570
TMPLSASSHS LQQGQQPTSL HTTVA
Length:575
Mass (Da):63,474
Last modified:April 13, 2004 - v2
Checksum:iE0B763C8262D03CA
GO
Isoform 2 (identifier: Q8BT14-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-274: RYDT → S

Show »
Length:572
Mass (Da):63,026
Checksum:i55D834DB87099436
GO
Isoform 3 (identifier: Q8BT14-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-575: GEEEVKVSTMPLSASSHSLQQGQQPTSLHTTVA → DNNSSVESLN...LLQSSTLDRH

Note: No experimental confirmation available.
Show »
Length:713
Mass (Da):78,264
Checksum:i49303EA33BFA7A55
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J1K1A0A0R4J1K1_MOUSE
CCR4-NOT transcription complex subu...
Cnot4
710Annotation score:
E9QA19E9QA19_MOUSE
CCR4-NOT transcription complex subu...
Cnot4
642Annotation score:
Q05BG1Q05BG1_MOUSE
CCR4-NOT transcription complex subu...
Cnot4
639Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti167E → Q in BAC25801 (PubMed:16141072).Curated1
Sequence conflicti177N → H in BAC25801 (PubMed:16141072).Curated1
Sequence conflicti207K → Q in BAC25801 (PubMed:16141072).Curated1
Sequence conflicti417D → Y in BAC27779 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009930271 – 274RYDT → S in isoform 2. 1 Publication4
Alternative sequenceiVSP_009931543 – 575GEEEV…HTTVA → DNNSSVESLNMKEWQDGLRA LLPNININFGGLPNSSSPSN ANHSAPTSNTATTDSVSWDS PGSWTDPAIITGIPASSGNT LDSIQDDNPPHWLKSLQALT EMDGPSAASSQPHHSAPFST QIPLHRASWNPYPPPSNPSS FHSPPPGFQTAFRPPSKTPT DLLQSSTLDRH in isoform 3. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U71269 mRNA Translation: AAD00181.1
AK009234 mRNA Translation: BAB26155.1
AK028190 mRNA Translation: BAC25801.1
AK032248 mRNA Translation: BAC27779.1
BC058778 mRNA Translation: AAH58778.1
CCDSiCCDS19999.1 [Q8BT14-1]
CCDS80520.1 [Q8BT14-2]
RefSeqiNP_001157883.1, NM_001164411.1 [Q8BT14-2]
NP_001157885.1, NM_001164413.1
NP_058573.3, NM_016877.4 [Q8BT14-1]
XP_011239709.1, XM_011241407.1 [Q8BT14-3]
XP_011239710.1, XM_011241408.2 [Q8BT14-3]
UniGeneiMm.214525
Mm.398182

Genome annotation databases

EnsembliENSMUST00000044163; ENSMUSP00000044137; ENSMUSG00000038784 [Q8BT14-1]
ENSMUST00000202417; ENSMUSP00000144409; ENSMUSG00000038784 [Q8BT14-2]
GeneIDi53621
KEGGimmu:53621
UCSCiuc009bid.2 mouse [Q8BT14-3]
uc009big.2 mouse [Q8BT14-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U71269 mRNA Translation: AAD00181.1
AK009234 mRNA Translation: BAB26155.1
AK028190 mRNA Translation: BAC25801.1
AK032248 mRNA Translation: BAC27779.1
BC058778 mRNA Translation: AAH58778.1
CCDSiCCDS19999.1 [Q8BT14-1]
CCDS80520.1 [Q8BT14-2]
RefSeqiNP_001157883.1, NM_001164411.1 [Q8BT14-2]
NP_001157885.1, NM_001164413.1
NP_058573.3, NM_016877.4 [Q8BT14-1]
XP_011239709.1, XM_011241407.1 [Q8BT14-3]
XP_011239710.1, XM_011241408.2 [Q8BT14-3]
UniGeneiMm.214525
Mm.398182

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CPINMR-A101-198[»]
ProteinModelPortaliQ8BT14
SMRiQ8BT14
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BT14, 2 interactors
STRINGi10090.ENSMUSP00000110645

PTM databases

iPTMnetiQ8BT14
PhosphoSitePlusiQ8BT14

Proteomic databases

PaxDbiQ8BT14
PRIDEiQ8BT14

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000044163; ENSMUSP00000044137; ENSMUSG00000038784 [Q8BT14-1]
ENSMUST00000202417; ENSMUSP00000144409; ENSMUSG00000038784 [Q8BT14-2]
GeneIDi53621
KEGGimmu:53621
UCSCiuc009bid.2 mouse [Q8BT14-3]
uc009big.2 mouse [Q8BT14-1]

Organism-specific databases

CTDi4850
MGIiMGI:1859026 Cnot4

Phylogenomic databases

eggNOGiKOG2068 Eukaryota
COG5175 LUCA
GeneTreeiENSGT00390000000068
HOGENOMiHOG000065696
HOVERGENiHBG051043
InParanoidiQ8BT14
KOiK10643
PhylomeDBiQ8BT14
TreeFamiTF106134

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-MMU-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Miscellaneous databases

EvolutionaryTraceiQ8BT14
PROiPR:Q8BT14
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038784 Expressed in 286 organ(s), highest expression level in skin of back
CleanExiMM_CNOT4
ExpressionAtlasiQ8BT14 baseline and differential
GenevisibleiQ8BT14 MM

Family and domain databases

CDDicd16618 mRING-HC-C4C4_CNOT4, 1 hit
cd12438 RRM_CNOT4, 1 hit
Gene3Di3.30.40.10, 1 hit
3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR034261 CNOT4_RRM
IPR039780 Mot2
IPR039515 NOT4_mRING-HC-C4C4
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR003954 RRM_dom_euk
IPR000571 Znf_CCCH
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR12603 PTHR12603, 2 hits
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00361 RRM_1, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50103 ZF_C3H1, 1 hit
PS50089 ZF_RING_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCNOT4_MOUSE
AccessioniPrimary (citable) accession number: Q8BT14
Secondary accession number(s): Q8CCR4, Q9CV74, Q9Z1D0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: November 7, 2018
This is version 148 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again