Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Condensin-2 complex subunit H2

Gene

Ncaph2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture (By similarity). May promote the resolution of double-strand DNA catenanes (intertwines) between sister chromatids. Condensin-mediated compaction likely increases tension in catenated sister chromatids, providing directionality for type II topoisomerase-mediated strand exchanges toward chromatid decatenation. Required for decatenation of chromatin bridges at anaphase. Early in neurogenesis, may play an essential role to ensure accurate mitotic chromosome condensation in neuron stem cells, ultimately affecting neuron pool and cortex size (PubMed:27737959). Seems to have lineage-specific role in T-cell development (By similarity).By similarity1 Publication

GO - Molecular functioni

  • chromatin binding Source: GO_Central

GO - Biological processi

Keywordsi

Biological processDNA condensation

Enzyme and pathway databases

ReactomeiR-MMU-2299718 Condensation of Prophase Chromosomes

Names & Taxonomyi

Protein namesi
Recommended name:
Condensin-2 complex subunit H2
Alternative name(s):
Kleisin-beta
Non-SMC condensin II complex subunit H2
Gene namesi
Name:Ncaph21 PublicationImported
Synonyms:D15Ertd785e
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1289164 Ncaph2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Defects in Ncaph2 are the cause of the nessy phenotype which is characterized by a specific defect in T-cell development. Nessy thymuses are smaller, with corticomedullary junctions less well defined, and cortical cells sparser than in wild-type. The thymocyte defect is typified by an increased proportion of CD4-CD8- DN T-cell progenitors. Only thymocyte differentiation is affected in Nessy mice and not cell differentiation.

Keywords - Diseasei

Disease mutation

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003262421 – 607Condensin-2 complex subunit H2Add BLAST607

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei19PhosphothreonineBy similarity1
Modified residuei95PhosphoserineBy similarity1
Modified residuei231PhosphoserineBy similarity1
Modified residuei235PhosphoserineCombined sources1
Modified residuei252PhosphoserineCombined sources1
Modified residuei494PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BSP2
PeptideAtlasiQ8BSP2
PRIDEiQ8BSP2

PTM databases

iPTMnetiQ8BSP2
PhosphoSitePlusiQ8BSP2

Expressioni

Gene expression databases

BgeeiENSMUSG00000008690 Expressed in 235 organ(s), highest expression level in bone marrow
CleanExiMM_NCAPH2
ExpressionAtlasiQ8BSP2 baseline and differential
GenevisibleiQ8BSP2 MM

Interactioni

Subunit structurei

Component of the condensin-2 complex, which contains the SMC2 and SMC4 heterodimer, and three non SMC subunits, NCAPG2, NCAPH2 and NCAPD3 that probably regulate the complex.By similarity

Protein-protein interaction databases

BioGridi206732, 1 interactor
ComplexPortaliCPX-986 Condensin II complex
IntActiQ8BSP2, 1 interactor
STRINGi10090.ENSMUSP00000074139

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2359 Eukaryota
ENOG4111BR3 LUCA
GeneTreeiENSGT00390000014443
HOVERGENiHBG098083
InParanoidiQ8BSP2
KOiK11490
OMAiFHVRLIG
OrthoDBiEOG091G0TAX
TreeFamiTF101164

Family and domain databases

InterProiView protein in InterPro
IPR031737 CNDH2_C
IPR031719 H2_M
IPR009378 H2_N
IPR031739 Ncaph2
PANTHERiPTHR14324 PTHR14324, 1 hit
PfamiView protein in Pfam
PF16858 CNDH2_C, 1 hit
PF16869 CNDH2_M, 1 hit
PF06278 CNDH2_N, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BSP2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDVEVRFAH LLQPIRDLTK NWEVDVAAQL GEYLEELDQI CISFDEGKTT
60 70 80 90 100
MNFIEAALLI QGSACVYSKK VEYLYSLVYQ ALDFISGKRR AKQLSLVQED
110 120 130 140 150
GSKKTVNSET PCETENEFLS LDDFPDSRAN VDLKNDQASS ELLIIPLLPM
160 170 180 190 200
ALVAPDEVEK NSSPLYSCQG DILASRKDFR MNTCMPNPRG CFMLDPVGMC
210 220 230 240 250
PVEPVVPVEP YPMSRSQKDP EDAEEQPMEV SRNGSPVPVP DISQEPDGPA
260 270 280 290 300
LSGGEEDAED GAEPLEVALE PAEPRTSQQS AILPRRYMLR ERQGAPEPAS
310 320 330 340 350
RLQETPDPWQ SLDPFDSLES KVFQKGKPYS VPPGVEEAPG QKRKRKGATK
360 370 380 390 400
LQDFHKWYLD AYAEHPDGRR ARRKGPTFAD MEVLYWKHVK EQLETLQKLR
410 420 430 440 450
RRKINERWLP GAKQDLWPTE EDRLEESLED LGVADDFLEP EEYVEEPAGV
460 470 480 490 500
MPEEAADLDA EAMPESLRYE ELVRRNVELF IATSQKFIQE TELSQRIRDW
510 520 530 540 550
EDTIQPLLQE QEQHVPFDIH IYGDQLASRF PQLNEWCPFS ELVAGQPAFE
560 570 580 590 600
VCRSMLASLQ LANDYTVEIT QQPGLEAAVD TMSLRLLTHQ RAHTRFQTYA

APSMAQP
Length:607
Mass (Da):68,945
Last modified:March 1, 2003 - v1
Checksum:i616CA03BDD647852
GO
Isoform 2 (identifier: Q8BSP2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-434: A → AA

Show »
Length:608
Mass (Da):69,017
Checksum:i58FD3EE7F8E59483
GO
Isoform 3 (identifier: Q8BSP2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEDVEVRFAHLLQPIRDLTKNWEVDVAAQLGEYLEE → MWRCALLTSCSPSGISLRTGRWTWRHSW

Note: No experimental confirmation available.
Show »
Length:599
Mass (Da):68,024
Checksum:i4332A8427EDA9AB8
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PY48E9PY48_MOUSE
Condensin-2 complex subunit H2
Ncaph2
576Annotation score:
D6RGR7D6RGR7_MOUSE
Condensin-2 complex subunit H2
Ncaph2
38Annotation score:

Sequence cautioni

The sequence AAH03900 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti83D → N in BAC39479 (PubMed:16141072).Curated1
Sequence conflicti208V → M in BAC29736 (PubMed:16141072).Curated1
Sequence conflicti218K → E in BAC37919 (PubMed:16141072).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti15I → N in Nessy. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0326411 – 36MEDVE…EYLEE → MWRCALLTSCSPSGISLRTG RWTWRHSW in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032642434A → AA in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004160 mRNA Translation: BAB23198.1
AK031135 mRNA Translation: BAC27270.1
AK037175 mRNA Translation: BAC29736.1
AK080447 mRNA Translation: BAC37919.1
AK085584 mRNA Translation: BAC39479.1
AK088294 mRNA Translation: BAC40265.1
AK146642 mRNA Translation: BAE27325.1
AK152158 mRNA Translation: BAE30993.1
AK163958 mRNA Translation: BAE37553.1
AK165250 mRNA Translation: BAE38104.1
BC003900 mRNA Translation: AAH03900.1 Different initiation.
CCDSiCCDS49700.1 [Q8BSP2-1]
CCDS70661.1 [Q8BSP2-2]
RefSeqiNP_001108604.1, NM_001115132.2 [Q8BSP2-1]
NP_001258530.1, NM_001271601.1 [Q8BSP2-2]
UniGeneiMm.143167

Genome annotation databases

EnsembliENSMUST00000074552; ENSMUSP00000074139; ENSMUSG00000008690 [Q8BSP2-1]
ENSMUST00000088717; ENSMUSP00000086095; ENSMUSG00000008690 [Q8BSP2-2]
GeneIDi52683
KEGGimmu:52683
UCSCiuc007xgg.3 mouse [Q8BSP2-2]
uc007xgh.3 mouse [Q8BSP2-1]
uc007xgk.3 mouse [Q8BSP2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004160 mRNA Translation: BAB23198.1
AK031135 mRNA Translation: BAC27270.1
AK037175 mRNA Translation: BAC29736.1
AK080447 mRNA Translation: BAC37919.1
AK085584 mRNA Translation: BAC39479.1
AK088294 mRNA Translation: BAC40265.1
AK146642 mRNA Translation: BAE27325.1
AK152158 mRNA Translation: BAE30993.1
AK163958 mRNA Translation: BAE37553.1
AK165250 mRNA Translation: BAE38104.1
BC003900 mRNA Translation: AAH03900.1 Different initiation.
CCDSiCCDS49700.1 [Q8BSP2-1]
CCDS70661.1 [Q8BSP2-2]
RefSeqiNP_001108604.1, NM_001115132.2 [Q8BSP2-1]
NP_001258530.1, NM_001271601.1 [Q8BSP2-2]
UniGeneiMm.143167

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206732, 1 interactor
ComplexPortaliCPX-986 Condensin II complex
IntActiQ8BSP2, 1 interactor
STRINGi10090.ENSMUSP00000074139

PTM databases

iPTMnetiQ8BSP2
PhosphoSitePlusiQ8BSP2

Proteomic databases

PaxDbiQ8BSP2
PeptideAtlasiQ8BSP2
PRIDEiQ8BSP2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000074552; ENSMUSP00000074139; ENSMUSG00000008690 [Q8BSP2-1]
ENSMUST00000088717; ENSMUSP00000086095; ENSMUSG00000008690 [Q8BSP2-2]
GeneIDi52683
KEGGimmu:52683
UCSCiuc007xgg.3 mouse [Q8BSP2-2]
uc007xgh.3 mouse [Q8BSP2-1]
uc007xgk.3 mouse [Q8BSP2-3]

Organism-specific databases

CTDi29781
MGIiMGI:1289164 Ncaph2

Phylogenomic databases

eggNOGiKOG2359 Eukaryota
ENOG4111BR3 LUCA
GeneTreeiENSGT00390000014443
HOVERGENiHBG098083
InParanoidiQ8BSP2
KOiK11490
OMAiFHVRLIG
OrthoDBiEOG091G0TAX
TreeFamiTF101164

Enzyme and pathway databases

ReactomeiR-MMU-2299718 Condensation of Prophase Chromosomes

Miscellaneous databases

ChiTaRSiNcaph2 mouse
PROiPR:Q8BSP2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000008690 Expressed in 235 organ(s), highest expression level in bone marrow
CleanExiMM_NCAPH2
ExpressionAtlasiQ8BSP2 baseline and differential
GenevisibleiQ8BSP2 MM

Family and domain databases

InterProiView protein in InterPro
IPR031737 CNDH2_C
IPR031719 H2_M
IPR009378 H2_N
IPR031739 Ncaph2
PANTHERiPTHR14324 PTHR14324, 1 hit
PfamiView protein in Pfam
PF16858 CNDH2_C, 1 hit
PF16869 CNDH2_M, 1 hit
PF06278 CNDH2_N, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCNDH2_MOUSE
AccessioniPrimary (citable) accession number: Q8BSP2
Secondary accession number(s): Q3TNI4
, Q8C2N3, Q8C3K9, Q8C4X8, Q8CAZ3, Q99L21, Q9CT99
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again