Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Condensin-2 complex subunit H2

Gene

Ncaph2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture (By similarity). May promote the resolution of double-strand DNA catenanes (intertwines) between sister chromatids. Condensin-mediated compaction likely increases tension in catenated sister chromatids, providing directionality for type II topoisomerase-mediated strand exchanges toward chromatid decatenation. Required for decatenation of chromatin bridges at anaphase. Early in neurogenesis, may play an essential role to ensure accurate mitotic chromosome condensation in neuron stem cells, ultimately affecting neuron pool and cortex size (PubMed:27737959). Seems to have lineage-specific role in T-cell development (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • chromatin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA condensation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2299718 Condensation of Prophase Chromosomes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Condensin-2 complex subunit H2
Alternative name(s):
Kleisin-beta
Non-SMC condensin II complex subunit H2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ncaph21 PublicationImported
Synonyms:D15Ertd785e
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1289164 Ncaph2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Ncaph2 are the cause of the nessy phenotype which is characterized by a specific defect in T-cell development. Nessy thymuses are smaller, with corticomedullary junctions less well defined, and cortical cells sparser than in wild-type. The thymocyte defect is typified by an increased proportion of CD4-CD8- DN T-cell progenitors. Only thymocyte differentiation is affected in Nessy mice and not cell differentiation.

Keywords - Diseasei

Disease mutation

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003262421 – 607Condensin-2 complex subunit H2Add BLAST607

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei19PhosphothreonineBy similarity1
Modified residuei95PhosphoserineBy similarity1
Modified residuei231PhosphoserineBy similarity1
Modified residuei235PhosphoserineCombined sources1
Modified residuei252PhosphoserineCombined sources1
Modified residuei494PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BSP2

PeptideAtlas

More...
PeptideAtlasi
Q8BSP2

PRoteomics IDEntifications database

More...
PRIDEi
Q8BSP2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BSP2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BSP2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000008690 Expressed in 235 organ(s), highest expression level in bone marrow

CleanEx database of gene expression profiles

More...
CleanExi
MM_NCAPH2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BSP2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BSP2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the condensin-2 complex, which contains the SMC2 and SMC4 heterodimer, and three non SMC subunits, NCAPG2, NCAPH2 and NCAPD3 that probably regulate the complex.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206732, 1 interactor

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-986 Condensin II complex

Protein interaction database and analysis system

More...
IntActi
Q8BSP2, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000074139

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2359 Eukaryota
ENOG4111BR3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014443

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG098083

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BSP2

KEGG Orthology (KO)

More...
KOi
K11490

Identification of Orthologs from Complete Genome Data

More...
OMAi
FHVRLIG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0TAX

TreeFam database of animal gene trees

More...
TreeFami
TF101164

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031737 CNDH2_C
IPR031719 H2_M
IPR009378 H2_N
IPR031739 Ncaph2

The PANTHER Classification System

More...
PANTHERi
PTHR14324 PTHR14324, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16858 CNDH2_C, 1 hit
PF16869 CNDH2_M, 1 hit
PF06278 CNDH2_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BSP2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDVEVRFAH LLQPIRDLTK NWEVDVAAQL GEYLEELDQI CISFDEGKTT
60 70 80 90 100
MNFIEAALLI QGSACVYSKK VEYLYSLVYQ ALDFISGKRR AKQLSLVQED
110 120 130 140 150
GSKKTVNSET PCETENEFLS LDDFPDSRAN VDLKNDQASS ELLIIPLLPM
160 170 180 190 200
ALVAPDEVEK NSSPLYSCQG DILASRKDFR MNTCMPNPRG CFMLDPVGMC
210 220 230 240 250
PVEPVVPVEP YPMSRSQKDP EDAEEQPMEV SRNGSPVPVP DISQEPDGPA
260 270 280 290 300
LSGGEEDAED GAEPLEVALE PAEPRTSQQS AILPRRYMLR ERQGAPEPAS
310 320 330 340 350
RLQETPDPWQ SLDPFDSLES KVFQKGKPYS VPPGVEEAPG QKRKRKGATK
360 370 380 390 400
LQDFHKWYLD AYAEHPDGRR ARRKGPTFAD MEVLYWKHVK EQLETLQKLR
410 420 430 440 450
RRKINERWLP GAKQDLWPTE EDRLEESLED LGVADDFLEP EEYVEEPAGV
460 470 480 490 500
MPEEAADLDA EAMPESLRYE ELVRRNVELF IATSQKFIQE TELSQRIRDW
510 520 530 540 550
EDTIQPLLQE QEQHVPFDIH IYGDQLASRF PQLNEWCPFS ELVAGQPAFE
560 570 580 590 600
VCRSMLASLQ LANDYTVEIT QQPGLEAAVD TMSLRLLTHQ RAHTRFQTYA

APSMAQP
Length:607
Mass (Da):68,945
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i616CA03BDD647852
GO
Isoform 2 (identifier: Q8BSP2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-434: A → AA

Show »
Length:608
Mass (Da):69,017
Checksum:i58FD3EE7F8E59483
GO
Isoform 3 (identifier: Q8BSP2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEDVEVRFAHLLQPIRDLTKNWEVDVAAQLGEYLEE → MWRCALLTSCSPSGISLRTGRWTWRHSW

Note: No experimental confirmation available.
Show »
Length:599
Mass (Da):68,024
Checksum:i4332A8427EDA9AB8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PY48E9PY48_MOUSE
Condensin-2 complex subunit H2
Ncaph2
576Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGR7D6RGR7_MOUSE
Condensin-2 complex subunit H2
Ncaph2
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH03900 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti83D → N in BAC39479 (PubMed:16141072).Curated1
Sequence conflicti208V → M in BAC29736 (PubMed:16141072).Curated1
Sequence conflicti218K → E in BAC37919 (PubMed:16141072).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti15I → N in Nessy. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0326411 – 36MEDVE…EYLEE → MWRCALLTSCSPSGISLRTG RWTWRHSW in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032642434A → AA in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK004160 mRNA Translation: BAB23198.1
AK031135 mRNA Translation: BAC27270.1
AK037175 mRNA Translation: BAC29736.1
AK080447 mRNA Translation: BAC37919.1
AK085584 mRNA Translation: BAC39479.1
AK088294 mRNA Translation: BAC40265.1
AK146642 mRNA Translation: BAE27325.1
AK152158 mRNA Translation: BAE30993.1
AK163958 mRNA Translation: BAE37553.1
AK165250 mRNA Translation: BAE38104.1
BC003900 mRNA Translation: AAH03900.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49700.1 [Q8BSP2-1]
CCDS70661.1 [Q8BSP2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001108604.1, NM_001115132.2 [Q8BSP2-1]
NP_001258530.1, NM_001271601.1 [Q8BSP2-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.143167

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000074552; ENSMUSP00000074139; ENSMUSG00000008690 [Q8BSP2-1]
ENSMUST00000088717; ENSMUSP00000086095; ENSMUSG00000008690 [Q8BSP2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
52683

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:52683

UCSC genome browser

More...
UCSCi
uc007xgg.3 mouse [Q8BSP2-2]
uc007xgh.3 mouse [Q8BSP2-1]
uc007xgk.3 mouse [Q8BSP2-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004160 mRNA Translation: BAB23198.1
AK031135 mRNA Translation: BAC27270.1
AK037175 mRNA Translation: BAC29736.1
AK080447 mRNA Translation: BAC37919.1
AK085584 mRNA Translation: BAC39479.1
AK088294 mRNA Translation: BAC40265.1
AK146642 mRNA Translation: BAE27325.1
AK152158 mRNA Translation: BAE30993.1
AK163958 mRNA Translation: BAE37553.1
AK165250 mRNA Translation: BAE38104.1
BC003900 mRNA Translation: AAH03900.1 Different initiation.
CCDSiCCDS49700.1 [Q8BSP2-1]
CCDS70661.1 [Q8BSP2-2]
RefSeqiNP_001108604.1, NM_001115132.2 [Q8BSP2-1]
NP_001258530.1, NM_001271601.1 [Q8BSP2-2]
UniGeneiMm.143167

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Protein-protein interaction databases

BioGridi206732, 1 interactor
ComplexPortaliCPX-986 Condensin II complex
IntActiQ8BSP2, 1 interactor
STRINGi10090.ENSMUSP00000074139

PTM databases

iPTMnetiQ8BSP2
PhosphoSitePlusiQ8BSP2

Proteomic databases

PaxDbiQ8BSP2
PeptideAtlasiQ8BSP2
PRIDEiQ8BSP2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000074552; ENSMUSP00000074139; ENSMUSG00000008690 [Q8BSP2-1]
ENSMUST00000088717; ENSMUSP00000086095; ENSMUSG00000008690 [Q8BSP2-2]
GeneIDi52683
KEGGimmu:52683
UCSCiuc007xgg.3 mouse [Q8BSP2-2]
uc007xgh.3 mouse [Q8BSP2-1]
uc007xgk.3 mouse [Q8BSP2-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29781
MGIiMGI:1289164 Ncaph2

Phylogenomic databases

eggNOGiKOG2359 Eukaryota
ENOG4111BR3 LUCA
GeneTreeiENSGT00390000014443
HOVERGENiHBG098083
InParanoidiQ8BSP2
KOiK11490
OMAiFHVRLIG
OrthoDBiEOG091G0TAX
TreeFamiTF101164

Enzyme and pathway databases

ReactomeiR-MMU-2299718 Condensation of Prophase Chromosomes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ncaph2 mouse

Protein Ontology

More...
PROi
PR:Q8BSP2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000008690 Expressed in 235 organ(s), highest expression level in bone marrow
CleanExiMM_NCAPH2
ExpressionAtlasiQ8BSP2 baseline and differential
GenevisibleiQ8BSP2 MM

Family and domain databases

InterProiView protein in InterPro
IPR031737 CNDH2_C
IPR031719 H2_M
IPR009378 H2_N
IPR031739 Ncaph2
PANTHERiPTHR14324 PTHR14324, 1 hit
PfamiView protein in Pfam
PF16858 CNDH2_C, 1 hit
PF16869 CNDH2_M, 1 hit
PF06278 CNDH2_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNDH2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BSP2
Secondary accession number(s): Q3TNI4
, Q8C2N3, Q8C3K9, Q8C4X8, Q8CAZ3, Q99L21, Q9CT99
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again