Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein bicaudal D homolog 1

Gene

Bicd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.By similarity

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

Names & Taxonomyi

Protein namesi
Recommended name:
Protein bicaudal D homolog 1
Short name:
Bic-D 1
Gene namesi
Name:Bicd1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1101760 Bicd1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002053581 – 835Protein bicaudal D homolog 1Add BLAST835

Proteomic databases

PaxDbiQ8BR07
PRIDEiQ8BR07

PTM databases

iPTMnetiQ8BR07
PhosphoSitePlusiQ8BR07

Expressioni

Tissue specificityi

Expressed in the brain, heart and skeletal muscle.

Developmental stagei

Expressed during embryonic development.

Gene expression databases

BgeeiENSMUSG00000003452 Expressed in 227 organ(s), highest expression level in sciatic nerve
CleanExiMM_BICD1
ExpressionAtlasiQ8BR07 baseline and differential
GenevisibleiQ8BR07 MM

Interactioni

Subunit structurei

Interacts with RAB6A. Interacts (via C-terminus) with RAB6B (GTP-bound); the interaction is direct (By similarity). Interacts with CLIP-115 and KIFC2.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ8BR07, 1 interactor
STRINGi10090.ENSMUSP00000084039

Structurei

Secondary structure

1835
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8BR07
SMRiQ8BR07
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni663 – 803Interaction with RAB6ABy similarityAdd BLAST141

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1 – 264Sequence analysisAdd BLAST264
Coiled coili320 – 519Sequence analysisAdd BLAST200
Coiled coili663 – 803Sequence analysisAdd BLAST141

Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0999 Eukaryota
ENOG410XR47 LUCA
GeneTreeiENSGT00390000004114
HOVERGENiHBG050686
InParanoidiQ8BR07
KOiK18739
TreeFamiTF323833

Family and domain databases

InterProiView protein in InterPro
IPR018477 BICD
PANTHERiPTHR31233 PTHR31233, 1 hit
PfamiView protein in Pfam
PF09730 BicD, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BR07-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAEEALKTV DQYKTEIERL TKELTETTHE KIQAAEYGLV VLEEKLTLKQ
60 70 80 90 100
QYDELEAEYD GLKQELEQLR EAFGQSFSIH RKVAEDGETR EETLLQESAS
110 120 130 140 150
KEAYYLNKIL EMQNELKQSR AVVTNVQAEN ERLSAVVQEL KENNEMVELQ
160 170 180 190 200
RIRMKDEIRE YKFREARLLQ DYTELEEENI TLQKLVSTLK QNQVEYEGLK
210 220 230 240 250
HEIKRFEEET VLLNSQLEDA IRLKEIAEHQ LEEALETLKN EREQKNNLRK
260 270 280 290 300
ELSQYINLSD SHISISVDGL KFAEDGSEPN NDDKMNGHIH GPLGKLNGDY
310 320 330 340 350
RTPTTRKGES LHPVSDLFSE LNISEIQKLK QQLIQVEREK AILLANLQES
360 370 380 390 400
QTQLEHTKGA LTEQHERVHR LTEHVNAMRG LQNSKEIKAE LDCEKGRNSA
410 420 430 440 450
EEAHDYEVDI NGLEILECKY RVAVTEVIDL KAEIKALKEK YNKSVENYTE
460 470 480 490 500
EKTKYESKIQ MYDEQVTNLE KTSKESGEKM AHMEKELQKM TGIANENHNT
510 520 530 540 550
LNTAQDELVT FSEELAQLYH HVCLCNNETP NRVMLDYYRQ SRVTRSGSLK
560 570 580 590 600
GPDDPRGLLS PRLSRRGVSS PVESRTSSEP VSKENTETSK EPSPTKTPTI
610 620 630 640 650
SPVITAPPSS PVLDTSDIRK EPMNIYNLNA IIRDQIKHLQ KAVDRSLQLS
660 670 680 690 700
RQRAAARELA PMIDKDKEAL MEEILKLKSL LSTKREQIAT LRAVLKANKQ
710 720 730 740 750
TAEVALANLK NKYENEKAMV TETMTKLRNE LKALKEDAAT FSSLRAMFAT
760 770 780 790 800
RCDEYVTQLD EMQRQLAAAE DEKKTLNTLL RMAIQQKLAL TQRLEDLEFD
810 820 830
HEQSRRSKGK LGKSKIGSPK IVSSLLPPYR HSAHN
Length:835
Mass (Da):95,896
Last modified:August 15, 2003 - v2
Checksum:i33E8D83C56077C40
GO
Isoform 2 (identifier: Q8BR07-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-210: EYEGLKHEIKRFEEET → RLKIFKKLYHRWIHMF
     211-835: Missing.

Note: Due to intron retention.
Show »
Length:210
Mass (Da):25,048
Checksum:i7421A683F2F4EF00
GO
Isoform 3 (identifier: Q8BR07-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     821-835: IVSSLLPPYRHSAHN → SGHCPQ

Note: No experimental confirmation available.
Show »
Length:826
Mass (Da):94,833
Checksum:i46DEDA7C1DF5E542
GO
Isoform 4 (identifier: Q8BR07-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     821-835: IVSSLLPPYRHSAHN → VSGEAPDTVPTIDTYLLHSQGPQIPTIRVSSGTQRKRYACSYCHSVVQCTGFS

Note: Due to intron retention.
Show »
Length:873
Mass (Da):99,949
Checksum:i8151D3939E13B329
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B2KG46B2KG46_MOUSE
Protein bicaudal D homolog 1
Bicd1
975Annotation score:
G3UXK5G3UXK5_MOUSE
Protein bicaudal D homolog 1
Bicd1
827Annotation score:
G3UY88G3UY88_MOUSE
Protein bicaudal D homolog 1
Bicd1
137Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti70R → K in CAC81709 (Ref. 4) Curated1
Sequence conflicti86D → N in BAC34733 (PubMed:16141072).Curated1
Sequence conflicti90R → Q in BAC38518 (PubMed:16141072).Curated1
Sequence conflicti111E → K in BAC30057 (PubMed:16141072).Curated1
Sequence conflicti312H → D in BAC32557 (PubMed:16141072).Curated1
Sequence conflicti470E → K in AAB94807 (PubMed:9367685).Curated1
Sequence conflicti632I → V in BAC32557 (PubMed:16141072).Curated1
Sequence conflicti796D → G in CAC81711 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007965195 – 210EYEGL…FEEET → RLKIFKKLYHRWIHMF in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_007966211 – 835Missing in isoform 2. 1 PublicationAdd BLAST625
Alternative sequenceiVSP_007967821 – 835IVSSL…HSAHN → SGHCPQ in isoform 3. CuratedAdd BLAST15
Alternative sequenceiVSP_007968821 – 835IVSSL…HSAHN → VSGEAPDTVPTIDTYLLHSQ GPQIPTIRVSSGTQRKRYAC SYCHSVVQCTGFS in isoform 4. CuratedAdd BLAST15

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK038585 mRNA Translation: BAC30057.1
AK043650 mRNA Translation: BAC31607.1
AK045975 mRNA Translation: BAC32557.1
AK051718 mRNA Translation: BAC34733.1
AK082523 mRNA Translation: BAC38518.1
BC016192 mRNA Translation: AAH16192.1
U90029 mRNA Translation: AAB94807.1
AJ288054 mRNA Translation: CAC81709.1
AJ288055 mRNA Translation: CAC81710.1
AJ288056 mRNA Translation: CAC81711.1
CCDSiCCDS39723.1 [Q8BR07-1]
CCDS51962.1 [Q8BR07-3]
RefSeqiNP_001106267.1, NM_001112796.2 [Q8BR07-3]
NP_033883.2, NM_009753.4 [Q8BR07-1]
UniGeneiMm.177181
Mm.260763

Genome annotation databases

EnsembliENSMUST00000086829; ENSMUSP00000084039; ENSMUSG00000003452 [Q8BR07-1]
ENSMUST00000111513; ENSMUSP00000107138; ENSMUSG00000003452 [Q8BR07-3]
GeneIDi12121
KEGGimmu:12121
UCSCiuc009eug.3 mouse [Q8BR07-2]
uc009euh.3 mouse [Q8BR07-1]
uc009eui.3 mouse [Q8BR07-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK038585 mRNA Translation: BAC30057.1
AK043650 mRNA Translation: BAC31607.1
AK045975 mRNA Translation: BAC32557.1
AK051718 mRNA Translation: BAC34733.1
AK082523 mRNA Translation: BAC38518.1
BC016192 mRNA Translation: AAH16192.1
U90029 mRNA Translation: AAB94807.1
AJ288054 mRNA Translation: CAC81709.1
AJ288055 mRNA Translation: CAC81710.1
AJ288056 mRNA Translation: CAC81711.1
CCDSiCCDS39723.1 [Q8BR07-1]
CCDS51962.1 [Q8BR07-3]
RefSeqiNP_001106267.1, NM_001112796.2 [Q8BR07-3]
NP_033883.2, NM_009753.4 [Q8BR07-1]
UniGeneiMm.177181
Mm.260763

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YTDX-ray1.50A/B711-808[»]
ProteinModelPortaliQ8BR07
SMRiQ8BR07
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8BR07, 1 interactor
STRINGi10090.ENSMUSP00000084039

PTM databases

iPTMnetiQ8BR07
PhosphoSitePlusiQ8BR07

Proteomic databases

PaxDbiQ8BR07
PRIDEiQ8BR07

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000086829; ENSMUSP00000084039; ENSMUSG00000003452 [Q8BR07-1]
ENSMUST00000111513; ENSMUSP00000107138; ENSMUSG00000003452 [Q8BR07-3]
GeneIDi12121
KEGGimmu:12121
UCSCiuc009eug.3 mouse [Q8BR07-2]
uc009euh.3 mouse [Q8BR07-1]
uc009eui.3 mouse [Q8BR07-3]

Organism-specific databases

CTDi636
MGIiMGI:1101760 Bicd1

Phylogenomic databases

eggNOGiKOG0999 Eukaryota
ENOG410XR47 LUCA
GeneTreeiENSGT00390000004114
HOVERGENiHBG050686
InParanoidiQ8BR07
KOiK18739
TreeFamiTF323833

Enzyme and pathway databases

ReactomeiR-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

Miscellaneous databases

PROiPR:Q8BR07
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000003452 Expressed in 227 organ(s), highest expression level in sciatic nerve
CleanExiMM_BICD1
ExpressionAtlasiQ8BR07 baseline and differential
GenevisibleiQ8BR07 MM

Family and domain databases

InterProiView protein in InterPro
IPR018477 BICD
PANTHERiPTHR31233 PTHR31233, 1 hit
PfamiView protein in Pfam
PF09730 BicD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBICD1_MOUSE
AccessioniPrimary (citable) accession number: Q8BR07
Secondary accession number(s): O55206
, Q8BQ18, Q8BRR8, Q8C4D3, Q8CAK6, Q8R2J4, Q8R2J5, Q8R2J6, Q91YP7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: August 15, 2003
Last modified: November 7, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again