Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (11 Dec 2019)
Sequence version 2 (15 Aug 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein bicaudal D homolog 1

Gene

Bicd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein bicaudal D homolog 1
Short name:
Bic-D 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Bicd1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1101760 Bicd1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Golgi apparatus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002053581 – 835Protein bicaudal D homolog 1Add BLAST835

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8BR07

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BR07

PRoteomics IDEntifications database

More...
PRIDEi
Q8BR07

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BR07

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BR07

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the brain, heart and skeletal muscle.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed during embryonic development.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000003452 Expressed in 227 organ(s), highest expression level in sciatic nerve

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BR07 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BR07 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAB6A.

Interacts (via C-terminus) with RAB6B (GTP-bound); the interaction is direct (By similarity).

Interacts with CLIP-115 and KIFC2.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8BR07, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000084039

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8BR07 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1835
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BR07

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni663 – 803Interaction with RAB6ABy similarityAdd BLAST141

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1 – 264Sequence analysisAdd BLAST264
Coiled coili320 – 519Sequence analysisAdd BLAST200
Coiled coili663 – 803Sequence analysisAdd BLAST141

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BicD family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0999 Eukaryota
ENOG410XR47 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154471

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BR07

KEGG Orthology (KO)

More...
KOi
K18739

Database of Orthologous Groups

More...
OrthoDBi
542877at2759

TreeFam database of animal gene trees

More...
TreeFami
TF323833

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018477 BICD

The PANTHER Classification System

More...
PANTHERi
PTHR31233 PTHR31233, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09730 BicD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BR07-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAEEALKTV DQYKTEIERL TKELTETTHE KIQAAEYGLV VLEEKLTLKQ
60 70 80 90 100
QYDELEAEYD GLKQELEQLR EAFGQSFSIH RKVAEDGETR EETLLQESAS
110 120 130 140 150
KEAYYLNKIL EMQNELKQSR AVVTNVQAEN ERLSAVVQEL KENNEMVELQ
160 170 180 190 200
RIRMKDEIRE YKFREARLLQ DYTELEEENI TLQKLVSTLK QNQVEYEGLK
210 220 230 240 250
HEIKRFEEET VLLNSQLEDA IRLKEIAEHQ LEEALETLKN EREQKNNLRK
260 270 280 290 300
ELSQYINLSD SHISISVDGL KFAEDGSEPN NDDKMNGHIH GPLGKLNGDY
310 320 330 340 350
RTPTTRKGES LHPVSDLFSE LNISEIQKLK QQLIQVEREK AILLANLQES
360 370 380 390 400
QTQLEHTKGA LTEQHERVHR LTEHVNAMRG LQNSKEIKAE LDCEKGRNSA
410 420 430 440 450
EEAHDYEVDI NGLEILECKY RVAVTEVIDL KAEIKALKEK YNKSVENYTE
460 470 480 490 500
EKTKYESKIQ MYDEQVTNLE KTSKESGEKM AHMEKELQKM TGIANENHNT
510 520 530 540 550
LNTAQDELVT FSEELAQLYH HVCLCNNETP NRVMLDYYRQ SRVTRSGSLK
560 570 580 590 600
GPDDPRGLLS PRLSRRGVSS PVESRTSSEP VSKENTETSK EPSPTKTPTI
610 620 630 640 650
SPVITAPPSS PVLDTSDIRK EPMNIYNLNA IIRDQIKHLQ KAVDRSLQLS
660 670 680 690 700
RQRAAARELA PMIDKDKEAL MEEILKLKSL LSTKREQIAT LRAVLKANKQ
710 720 730 740 750
TAEVALANLK NKYENEKAMV TETMTKLRNE LKALKEDAAT FSSLRAMFAT
760 770 780 790 800
RCDEYVTQLD EMQRQLAAAE DEKKTLNTLL RMAIQQKLAL TQRLEDLEFD
810 820 830
HEQSRRSKGK LGKSKIGSPK IVSSLLPPYR HSAHN
Length:835
Mass (Da):95,896
Last modified:August 15, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i33E8D83C56077C40
GO
Isoform 2 (identifier: Q8BR07-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-210: EYEGLKHEIKRFEEET → RLKIFKKLYHRWIHMF
     211-835: Missing.

Note: Due to intron retention.Curated
Show »
Length:210
Mass (Da):25,048
Checksum:i7421A683F2F4EF00
GO
Isoform 3 (identifier: Q8BR07-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     821-835: IVSSLLPPYRHSAHN → SGHCPQ

Show »
Length:826
Mass (Da):94,833
Checksum:i46DEDA7C1DF5E542
GO
Isoform 4 (identifier: Q8BR07-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     821-835: IVSSLLPPYRHSAHN → VSGEAPDTVPTIDTYLLHSQGPQIPTIRVSSGTQRKRYACSYCHSVVQCTGFS

Note: Due to intron retention.Curated
Show »
Length:873
Mass (Da):99,949
Checksum:i8151D3939E13B329
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B2KG46B2KG46_MOUSE
Protein bicaudal D homolog 1
Bicd1
975Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UXK5G3UXK5_MOUSE
Protein bicaudal D homolog 1
Bicd1
827Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UY88G3UY88_MOUSE
Protein bicaudal D homolog 1
Bicd1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti70R → K in CAC81709 (Ref. 4) Curated1
Sequence conflicti86D → N in BAC34733 (PubMed:16141072).Curated1
Sequence conflicti90R → Q in BAC38518 (PubMed:16141072).Curated1
Sequence conflicti111E → K in BAC30057 (PubMed:16141072).Curated1
Sequence conflicti312H → D in BAC32557 (PubMed:16141072).Curated1
Sequence conflicti470E → K in AAB94807 (PubMed:9367685).Curated1
Sequence conflicti632I → V in BAC32557 (PubMed:16141072).Curated1
Sequence conflicti796D → G in CAC81711 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007965195 – 210EYEGL…FEEET → RLKIFKKLYHRWIHMF in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_007966211 – 835Missing in isoform 2. 1 PublicationAdd BLAST625
Alternative sequenceiVSP_007967821 – 835IVSSL…HSAHN → SGHCPQ in isoform 3. CuratedAdd BLAST15
Alternative sequenceiVSP_007968821 – 835IVSSL…HSAHN → VSGEAPDTVPTIDTYLLHSQ GPQIPTIRVSSGTQRKRYAC SYCHSVVQCTGFS in isoform 4. CuratedAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK038585 mRNA Translation: BAC30057.1
AK043650 mRNA Translation: BAC31607.1
AK045975 mRNA Translation: BAC32557.1
AK051718 mRNA Translation: BAC34733.1
AK082523 mRNA Translation: BAC38518.1
BC016192 mRNA Translation: AAH16192.1
U90029 mRNA Translation: AAB94807.1
AJ288054 mRNA Translation: CAC81709.1
AJ288055 mRNA Translation: CAC81710.1
AJ288056 mRNA Translation: CAC81711.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39723.1 [Q8BR07-1]
CCDS51962.1 [Q8BR07-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001106267.1, NM_001112796.2 [Q8BR07-3]
NP_033883.2, NM_009753.4 [Q8BR07-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000086829; ENSMUSP00000084039; ENSMUSG00000003452 [Q8BR07-1]
ENSMUST00000111513; ENSMUSP00000107138; ENSMUSG00000003452 [Q8BR07-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12121

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12121

UCSC genome browser

More...
UCSCi
uc009eug.3 mouse [Q8BR07-2]
uc009euh.3 mouse [Q8BR07-1]
uc009eui.3 mouse [Q8BR07-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK038585 mRNA Translation: BAC30057.1
AK043650 mRNA Translation: BAC31607.1
AK045975 mRNA Translation: BAC32557.1
AK051718 mRNA Translation: BAC34733.1
AK082523 mRNA Translation: BAC38518.1
BC016192 mRNA Translation: AAH16192.1
U90029 mRNA Translation: AAB94807.1
AJ288054 mRNA Translation: CAC81709.1
AJ288055 mRNA Translation: CAC81710.1
AJ288056 mRNA Translation: CAC81711.1
CCDSiCCDS39723.1 [Q8BR07-1]
CCDS51962.1 [Q8BR07-3]
RefSeqiNP_001106267.1, NM_001112796.2 [Q8BR07-3]
NP_033883.2, NM_009753.4 [Q8BR07-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YTDX-ray1.50A/B711-808[»]
SMRiQ8BR07
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

IntActiQ8BR07, 1 interactor
STRINGi10090.ENSMUSP00000084039

PTM databases

iPTMnetiQ8BR07
PhosphoSitePlusiQ8BR07

Proteomic databases

jPOSTiQ8BR07
PaxDbiQ8BR07
PRIDEiQ8BR07

Genome annotation databases

EnsembliENSMUST00000086829; ENSMUSP00000084039; ENSMUSG00000003452 [Q8BR07-1]
ENSMUST00000111513; ENSMUSP00000107138; ENSMUSG00000003452 [Q8BR07-3]
GeneIDi12121
KEGGimmu:12121
UCSCiuc009eug.3 mouse [Q8BR07-2]
uc009euh.3 mouse [Q8BR07-1]
uc009eui.3 mouse [Q8BR07-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
636
MGIiMGI:1101760 Bicd1

Phylogenomic databases

eggNOGiKOG0999 Eukaryota
ENOG410XR47 LUCA
GeneTreeiENSGT00940000154471
InParanoidiQ8BR07
KOiK18739
OrthoDBi542877at2759
TreeFamiTF323833

Enzyme and pathway databases

ReactomeiR-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Bicd1 mouse

Protein Ontology

More...
PROi
PR:Q8BR07
RNActiQ8BR07 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000003452 Expressed in 227 organ(s), highest expression level in sciatic nerve
ExpressionAtlasiQ8BR07 baseline and differential
GenevisibleiQ8BR07 MM

Family and domain databases

InterProiView protein in InterPro
IPR018477 BICD
PANTHERiPTHR31233 PTHR31233, 1 hit
PfamiView protein in Pfam
PF09730 BicD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBICD1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BR07
Secondary accession number(s): O55206
, Q8BQ18, Q8BRR8, Q8C4D3, Q8CAK6, Q8R2J4, Q8R2J5, Q8R2J6, Q91YP7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: August 15, 2003
Last modified: December 11, 2019
This is version 121 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again