Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Checkpoint protein HUS1

Gene

Hus1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase (By similarity).By similarity

GO - Biological processi

Keywordsi

Biological processDNA damage

Enzyme and pathway databases

ReactomeiR-MMU-176187 Activation of ATR in response to replication stress
R-MMU-5685938 HDR through Single Strand Annealing (SSA)
R-MMU-5693607 Processing of DNA double-strand break ends
R-MMU-6804756 Regulation of TP53 Activity through Phosphorylation
R-MMU-69473 G2/M DNA damage checkpoint

Names & Taxonomyi

Protein namesi
Recommended name:
Checkpoint protein HUS1
Short name:
mHUS1
Gene namesi
Name:Hus1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1277962 Hus1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002250041 – 280Checkpoint protein HUS1Add BLAST280

Proteomic databases

EPDiQ8BQY8
PaxDbiQ8BQY8
PeptideAtlasiQ8BQY8
PRIDEiQ8BQY8

PTM databases

PhosphoSitePlusiQ8BQY8

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSMUSG00000020413 Expressed in 275 organ(s), highest expression level in secondary oocyte
CleanExiMM_HUS1
GenevisibleiQ8BQY8 MM

Interactioni

Subunit structurei

Component of the toroidal 9-1-1 (RAD9-RAD1-HUS1) complex, composed of RAD9A, RAD1 and HUS1. The 9-1-1 complex associates with LIG1, POLB, FEN1, RAD17, HDAC1, RPA1 and RPA2. The 9-1-1 complex associates with the RAD17-RFC complex. HUS1 interacts with POLB, HDAC1, FEN1, PCNA, RAD1, RAD9A and RAD9B. HUS1 does not interact with RAD17. Interacts with DNAJC7 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000020683

Structurei

3D structure databases

ProteinModelPortaliQ8BQY8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the HUS1 family.Curated

Phylogenomic databases

eggNOGiKOG3999 Eukaryota
ENOG410ZQ9J LUCA
GeneTreeiENSGT00390000000706
HOGENOMiHOG000253011
HOVERGENiHBG053069
InParanoidiQ8BQY8
KOiK10903
OMAiCMILYVY
OrthoDBiEOG091G0H06
PhylomeDBiQ8BQY8
TreeFamiTF314491

Family and domain databases

InterProiView protein in InterPro
IPR016580 Cell_cycle_HUS1
IPR007150 Hus1/Mec3
PfamiView protein in Pfam
PF04005 Hus1, 1 hit
PIRSFiPIRSF011312 Cell_cycle_HUS1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8BQY8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKFRAKIVDL ACLNHFTRVS NMIAKLAKTC TLRISPEKLN FILCDKLASG
60 70 80 90 100
GVSMWCELEQ ENFFSEFQME GVSEENNEIY LELTSENLSR ALKTAQNSRA
110 120 130 140 150
LKIKLTNKHF PCLTVSVELV SSSSSSRIVV HDIPIKVLPR RLWKDLQEPS
160 170 180 190 200
IPDCDVSICL PALKMMKSVV EKMRNISNQL VIEANLKGEL NLKIETELVC
210 220 230 240 250
VTTHFKDLEN PLLPSDSVSQ NRHPEDMAKV HIDIKKLLQF LAGQQVTPTK
260 270 280
AVCNIVNNRT VHFDLLLEDV SLQYFIPALS
Length:280
Mass (Da):31,680
Last modified:March 1, 2003 - v1
Checksum:i8721B79853E6150D
GO
Isoform 2 (identifier: Q8BQY8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-119: L → LQ

Show »
Length:281
Mass (Da):31,808
Checksum:iE34F90D989912285
GO
Isoform 3 (identifier: Q8BQY8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-119: L → LQ
     254-280: NIVNNRTVHFDLLLEDVSLQYFIPALS → SEFASPLSTSFVLHMQVCPVLAIELPETVRLERSLEPEVSRDAEEE

Note: No experimental confirmation available.
Show »
Length:300
Mass (Da):33,848
Checksum:i947D0A24ECE9CB71
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017332119L → LQ in isoform 2 and isoform 3. 4 Publications1
Alternative sequenceiVSP_017333254 – 280NIVNN…IPALS → SEFASPLSTSFVLHMQVCPV LAIELPETVRLERSLEPEVS RDAEEE in isoform 3. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16894 mRNA Translation: CAA76519.1
AF076845 mRNA Translation: AAC95527.1
AK046152 mRNA Translation: BAC32614.1
AK088403 mRNA Translation: BAC40332.1
AK135922 mRNA Translation: BAE22725.1
AL669837 Genomic DNA No translation available.
BC061249 mRNA Translation: AAH61249.1
CCDSiCCDS24429.1 [Q8BQY8-2]
RefSeqiNP_001290461.1, NM_001303532.1 [Q8BQY8-1]
NP_032342.1, NM_008316.5 [Q8BQY8-2]
XP_006514594.1, XM_006514531.3 [Q8BQY8-3]
UniGeneiMm.42201

Genome annotation databases

EnsembliENSMUST00000020683; ENSMUSP00000020683; ENSMUSG00000020413 [Q8BQY8-2]
ENSMUST00000129115; ENSMUSP00000114339; ENSMUSG00000020413 [Q8BQY8-2]
GeneIDi15574
KEGGimmu:15574
UCSCiuc007hzp.2 mouse [Q8BQY8-1]
uc007hzq.2 mouse [Q8BQY8-2]
uc007hzs.2 mouse [Q8BQY8-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16894 mRNA Translation: CAA76519.1
AF076845 mRNA Translation: AAC95527.1
AK046152 mRNA Translation: BAC32614.1
AK088403 mRNA Translation: BAC40332.1
AK135922 mRNA Translation: BAE22725.1
AL669837 Genomic DNA No translation available.
BC061249 mRNA Translation: AAH61249.1
CCDSiCCDS24429.1 [Q8BQY8-2]
RefSeqiNP_001290461.1, NM_001303532.1 [Q8BQY8-1]
NP_032342.1, NM_008316.5 [Q8BQY8-2]
XP_006514594.1, XM_006514531.3 [Q8BQY8-3]
UniGeneiMm.42201

3D structure databases

ProteinModelPortaliQ8BQY8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000020683

PTM databases

PhosphoSitePlusiQ8BQY8

Proteomic databases

EPDiQ8BQY8
PaxDbiQ8BQY8
PeptideAtlasiQ8BQY8
PRIDEiQ8BQY8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000020683; ENSMUSP00000020683; ENSMUSG00000020413 [Q8BQY8-2]
ENSMUST00000129115; ENSMUSP00000114339; ENSMUSG00000020413 [Q8BQY8-2]
GeneIDi15574
KEGGimmu:15574
UCSCiuc007hzp.2 mouse [Q8BQY8-1]
uc007hzq.2 mouse [Q8BQY8-2]
uc007hzs.2 mouse [Q8BQY8-3]

Organism-specific databases

CTDi3364
MGIiMGI:1277962 Hus1

Phylogenomic databases

eggNOGiKOG3999 Eukaryota
ENOG410ZQ9J LUCA
GeneTreeiENSGT00390000000706
HOGENOMiHOG000253011
HOVERGENiHBG053069
InParanoidiQ8BQY8
KOiK10903
OMAiCMILYVY
OrthoDBiEOG091G0H06
PhylomeDBiQ8BQY8
TreeFamiTF314491

Enzyme and pathway databases

ReactomeiR-MMU-176187 Activation of ATR in response to replication stress
R-MMU-5685938 HDR through Single Strand Annealing (SSA)
R-MMU-5693607 Processing of DNA double-strand break ends
R-MMU-6804756 Regulation of TP53 Activity through Phosphorylation
R-MMU-69473 G2/M DNA damage checkpoint

Miscellaneous databases

PROiPR:Q8BQY8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020413 Expressed in 275 organ(s), highest expression level in secondary oocyte
CleanExiMM_HUS1
GenevisibleiQ8BQY8 MM

Family and domain databases

InterProiView protein in InterPro
IPR016580 Cell_cycle_HUS1
IPR007150 Hus1/Mec3
PfamiView protein in Pfam
PF04005 Hus1, 1 hit
PIRSFiPIRSF011312 Cell_cycle_HUS1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHUS1_MOUSE
AccessioniPrimary (citable) accession number: Q8BQY8
Secondary accession number(s): O70543, Q6P8H5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 117 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again