Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mediator of RNA polymerase II transcription subunit 12-like protein

Gene

Med12l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).By similarity

GO - Molecular functioni

  • beta-catenin binding Source: InterPro
  • transcription coactivator activity Source: GO_Central
  • transcription factor binding Source: MGI

GO - Biological processi

Keywordsi

Molecular functionActivator, Repressor
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Mediator of RNA polymerase II transcription subunit 12-like protein
Alternative name(s):
Mediator complex subunit 12-like protein
Gene namesi
Name:Med12l
Synonyms:Kiaa3007
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:2139916 Med12l

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003130541 – 2157Mediator of RNA polymerase II transcription subunit 12-like proteinAdd BLAST2157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei462PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8BQM9
PeptideAtlasiQ8BQM9
PRIDEiQ8BQM9

PTM databases

iPTMnetiQ8BQM9
PhosphoSitePlusiQ8BQM9

Expressioni

Gene expression databases

BgeeiENSMUSG00000056476 Expressed in 219 organ(s), highest expression level in substantia nigra
ExpressionAtlasiQ8BQM9 baseline and differential
GenevisibleiQ8BQM9 MM

Interactioni

Subunit structurei

May be a component of the Mediator complex, which is known to be composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000127038

Structurei

3D structure databases

SMRiQ8BQM9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1880 – 2146Gln-richAdd BLAST267

Sequence similaritiesi

Belongs to the Mediator complex subunit 12 family.Curated

Phylogenomic databases

eggNOGiKOG3598 Eukaryota
ENOG410XP2V LUCA
GeneTreeiENSGT00440000037505
HOGENOMiHOG000231423
HOVERGENiHBG052447
InParanoidiQ8BQM9
KOiK15162
OrthoDBiEOG091G00I6
PhylomeDBiQ8BQM9
TreeFamiTF324178

Family and domain databases

InterProiView protein in InterPro
IPR019035 Mediator_Med12
IPR021989 Mediator_Med12_catenin-bd
IPR021990 Mediator_Med12_LCEWAV
PfamiView protein in Pfam
PF09497 Med12, 1 hit
PF12145 Med12-LCEWAV, 1 hit
PF12144 Med12-PQL, 1 hit
SMARTiView protein in SMART
SM01281 Med12, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BQM9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAFGLLSYE QRPLKRPRLG PPDVYPQDPK QKEDELTAVN VKQGFNNQPA
60 70 80 90 100
FTGDEHGSAR NIVINPSKIG AYFSSILAEK LKLNTFQDTG KKKPQVNAKD
110 120 130 140 150
NYWLVTARSQ SAIHSWFSDL AGNKPLAILA KKVPILSKKE DVFAYLAKYS
160 170 180 190 200
VPMVRATWLI KMTCAYYSAI SEAKIKKRQA PDPNLEWTQI STRYLREQLV
210 220 230 240 250
KISDFYHMAS STGDGPVPVP PEVEQAMKQW EYNEKLAFHM FQEGMLEKHE
260 270 280 290 300
YLTWILDVLE KIRPVDDSLL KLLLPLMLQY SDEFVQSAYL SRRLAYFCAR
310 320 330 340 350
RLSLLLSDSP NLLAAHSPHM IIGTNNTSIG TPSPGTPGPG MSPVQLAFSD
360 370 380 390 400
FLSCAQHGPL VYGLSCMLQT VTLCCPSALV WNYSTNENKI SNPGSPLDLL
410 420 430 440 450
QVAPSSLPMP GGNTAFNQQV RARIYEVEQQ IKQRGRAVEV RWSFDKCQES
460 470 480 490 500
TAGVTISRVL HTLEVLDRHC FDRTDSSNSM ETLYHKIFWA NQNKDNQEVA
510 520 530 540 550
PNDEAVVTLL CEWAVSCKRS GKHRAMAVAK LLEKRQAEIE AERCGESEVL
560 570 580 590 600
DEKESISSAS LAGSSLPVFQ NVLLRFLDTQ APALSDPNSE CEKVEFVNLV
610 620 630 640 650
LLFCEFIRHD VFSHDAYMCT LISRGDLSVT ASTGLRSPAG ENSDEHYSKD
660 670 680 690 700
HDMKMEIFSP MPGESCENIN PSLSRRLSVN GEKLLKREKP RELIFPSNYD
710 720 730 740 750
LLRHLQYATH FPIPLDESSS HECNQRTILL YGVGKERDEA RHQLKKITKD
760 770 780 790 800
ILKILNKKGT TESGVGDEGQ KARKTKQEVF PTPENVFTKL QLLSYFDQHQ
810 820 830 840 850
VTSQISNNVL EQITSFASGT SYHLPLAHHI QLIFDLMEPA LNINGLIDFA
860 870 880 890 900
IQLLNELSVV EAELLLKSSS LAGSYTTGLC VCIVAVLRRY HSCLILNPDQ
910 920 930 940 950
TAQVFEGLCG VVKHVVNPSE CSSPERCILA YLYDLYVSCS HLRSKFGDLF
960 970 980 990 1000
SSACSKVKQT IYNNVMPANS NLRWDPDFMM DFIENPSARS INYSMLGKIL
1010 1020 1030 1040 1050
NDNAANRYSF VCNTLMNVCM GHQDAGRIND IANFSSELTA CCTVLSSEWL
1060 1070 1080 1090 1100
GVLKALCCSS NHVWGFNDVL CTVDVSDLSF HDSLATFIAI LIARQCFSLE
1110 1120 1130 1140 1150
DVVQHVALPS LLAAACGDAD AEPGARMTCR LLLHLFRAPQ ACFFPQGTGK
1160 1170 1180 1190 1200
PFPGIRSSCD RHLLAAAHNS IEVGAVFAVL KAIMMLGDAK IGSNNVNTMK
1210 1220 1230 1240 1250
NEDFGMRGLR RDGNAEDAWA TSQNSKSYGK SISIETANLR EYARYVLRTI
1260 1270 1280 1290 1300
CQQEWVGEHC LKEPERLCTD KELILDPVLS NMQAQKLLQL ICYPHGIKEC
1310 1320 1330 1340 1350
TEGDNLQRQH IKRILQNLEQ WTLRQSWLEL QLMIKQCLKD PSSGSVAEMN
1360 1370 1380 1390 1400
NLLDNIAKAT IEVFQQSADL NNNASNSGMS LFNPNTIGSV DPSSTRQNGI
1410 1420 1430 1440 1450
KTFLSSSERR GVWLVAPLIA RLPTSVQGRV LKAAGEELEK GQHLGSSSKK
1460 1470 1480 1490 1500
ERDRQKQKSM SLLSQQPFLS LVLTCLKGQD EQREGLLTSL QNQVNQILSN
1510 1520 1530 1540 1550
WREERYQDDT KARQMMHEAL QLRLNLVGGM FDTVQRSTQG TTDWALLLLQ
1560 1570 1580 1590 1600
IITSGTVDMH TNNELFTTVL DMLGVLINGT LASDLSSASP GGSEENKRAY
1610 1620 1630 1640 1650
MNLVKKLKKE LGDKRSESID KVRQLLPLPK QTCDVITCEP MGSLIDTKGN
1660 1670 1680 1690 1700
KIAGFDSIDK KQARGLQVST KQKVSPWDLF EGQKNPAPLS WAWFGTVRVD
1710 1720 1730 1740 1750
RKVIKYEEQQ HFLLYHTHTM PKPRSYYLEP LPLPPEEEEE ELTSPVSQEP
1760 1770 1780 1790 1800
ERKSAELSDQ GKATADEEKK TKGRKRKTKS SSRIDEYQQT NLYRVPPNYS
1810 1820 1830 1840 1850
PMSSQMTHHP QPALWGYNLV SQPQQPSFFL QNPSLNPGGS RLDPAGSFVP
1860 1870 1880 1890 1900
TNTKQALSNM LQRRSGAMLQ PPSLHAVTSQ QQLLQMKLLQ QQQQQQQQQQ
1910 1920 1930 1940 1950
QQQQRLLRQA QTRPFQQGQP GDQAALFTAQ ARPSPQLPQY PGLQQAQTMP
1960 1970 1980 1990 2000
QGYTMYGTQM PLQQAAQQQP GGVVLSPSYN SRAYPAAHSS PALMERLRQL
2010 2020 2030 2040 2050
QQQPSGYVQQ QASPYLQPVA GSQRLNHQAL QQSPLVGGGI DAVLTPAHPN
2060 2070 2080 2090 2100
LPSVPLPQDP MRPRQQQVRQ QQRLLQVWGR EMQQPQQAPQ PQQPSQTQSQ
2110 2120 2130 2140 2150
ALGLQAMQPQ QPLFPRQGLQ QTQQQQQTAA LVRQLQKQLS SNQPQQGVTP

CAHPSHF
Length:2,157
Mass (Da):241,426
Last modified:January 15, 2008 - v2
Checksum:i4385941E622D8B9B
GO
Isoform 2 (identifier: Q8BQM9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-656: E → EEHSVMARLGLGSGATHIFDDVDKSDFKSDPASEFP

Note: No experimental confirmation available.
Show »
Length:2,192
Mass (Da):245,172
Checksum:i5A6EA9AAB84F6058
GO
Isoform 3 (identifier: Q8BQM9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-132: K → KELPLAKSGVPQ
     716-745: DESSSHECNQRTILLYGVGKERDEARHQLK → VRHVSISVYHDDFIRPSVIGCQIIHSLCLL
     746-2157: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):84,929
Checksum:i25DBDDFACCECFE5F
GO
Isoform 4 (identifier: Q8BQM9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-132: K → KELPLAKSGVPQ
     716-721: DESSSH → GILAMW
     722-2157: Missing.

Note: No experimental confirmation available.
Show »
Length:732
Mass (Da):82,198
Checksum:i14D0FE7E04124A34
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JET8A0A0G2JET8_MOUSE
Mediator of RNA polymerase II trans...
Med12l
2,185Annotation score:
A0A0G2JG45A0A0G2JG45_MOUSE
Mediator of RNA polymerase II trans...
Med12l
301Annotation score:

Sequence cautioni

The sequence BAC98285 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_029998132K → KELPLAKSGVPQ in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_029999656E → EEHSVMARLGLGSGATHIFD DVDKSDFKSDPASEFP in isoform 2. 1 Publication1
Alternative sequenceiVSP_030000716 – 745DESSS…RHQLK → VRHVSISVYHDDFIRPSVIG CQIIHSLCLL in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_030001716 – 721DESSSH → GILAMW in isoform 4. 1 Publication6
Alternative sequenceiVSP_030002722 – 2157Missing in isoform 4. 1 PublicationAdd BLAST1436
Alternative sequenceiVSP_030003746 – 2157Missing in isoform 3. 1 PublicationAdd BLAST1412

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129475 mRNA Translation: BAC98285.1 Different initiation.
AK042296 mRNA Translation: BAC31219.1
AK047743 mRNA Translation: BAC33144.1
AC115919 Genomic DNA No translation available.
AC122038 Genomic DNA No translation available.
RefSeqiNP_808523.2, NM_177855.3
UniGeneiMm.240059

Genome annotation databases

EnsembliENSMUST00000029393; ENSMUSP00000029393; ENSMUSG00000056476 [Q8BQM9-3]
ENSMUST00000040325; ENSMUSP00000042269; ENSMUSG00000056476 [Q8BQM9-1]
ENSMUST00000040846; ENSMUSP00000041859; ENSMUSG00000056476 [Q8BQM9-3]
ENSMUST00000164225; ENSMUSP00000127038; ENSMUSG00000056476 [Q8BQM9-2]
GeneIDi329650
KEGGimmu:329650
UCSCiuc008pig.1 mouse [Q8BQM9-3]
uc008pih.1 mouse [Q8BQM9-4]
uc008pii.2 mouse [Q8BQM9-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129475 mRNA Translation: BAC98285.1 Different initiation.
AK042296 mRNA Translation: BAC31219.1
AK047743 mRNA Translation: BAC33144.1
AC115919 Genomic DNA No translation available.
AC122038 Genomic DNA No translation available.
RefSeqiNP_808523.2, NM_177855.3
UniGeneiMm.240059

3D structure databases

SMRiQ8BQM9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000127038

PTM databases

iPTMnetiQ8BQM9
PhosphoSitePlusiQ8BQM9

Proteomic databases

PaxDbiQ8BQM9
PeptideAtlasiQ8BQM9
PRIDEiQ8BQM9

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029393; ENSMUSP00000029393; ENSMUSG00000056476 [Q8BQM9-3]
ENSMUST00000040325; ENSMUSP00000042269; ENSMUSG00000056476 [Q8BQM9-1]
ENSMUST00000040846; ENSMUSP00000041859; ENSMUSG00000056476 [Q8BQM9-3]
ENSMUST00000164225; ENSMUSP00000127038; ENSMUSG00000056476 [Q8BQM9-2]
GeneIDi329650
KEGGimmu:329650
UCSCiuc008pig.1 mouse [Q8BQM9-3]
uc008pih.1 mouse [Q8BQM9-4]
uc008pii.2 mouse [Q8BQM9-2]

Organism-specific databases

CTDi116931
MGIiMGI:2139916 Med12l
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3598 Eukaryota
ENOG410XP2V LUCA
GeneTreeiENSGT00440000037505
HOGENOMiHOG000231423
HOVERGENiHBG052447
InParanoidiQ8BQM9
KOiK15162
OrthoDBiEOG091G00I6
PhylomeDBiQ8BQM9
TreeFamiTF324178

Miscellaneous databases

PROiPR:Q8BQM9
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000056476 Expressed in 219 organ(s), highest expression level in substantia nigra
ExpressionAtlasiQ8BQM9 baseline and differential
GenevisibleiQ8BQM9 MM

Family and domain databases

InterProiView protein in InterPro
IPR019035 Mediator_Med12
IPR021989 Mediator_Med12_catenin-bd
IPR021990 Mediator_Med12_LCEWAV
PfamiView protein in Pfam
PF09497 Med12, 1 hit
PF12145 Med12-LCEWAV, 1 hit
PF12144 Med12-PQL, 1 hit
SMARTiView protein in SMART
SM01281 Med12, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMD12L_MOUSE
AccessioniPrimary (citable) accession number: Q8BQM9
Secondary accession number(s): Q6ZPF2, Q8C9E3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: November 7, 2018
This is version 112 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again