Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (08 May 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/arginine-rich splicing factor 7

Gene

Srsf7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10. May function as export adapter involved in mRNA nuclear export such as of histone H2A. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. RNA-binding is semi-sequence specific (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri133 – 150CCHC-typePROSITE-ProRule annotationAdd BLAST18

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor, RNA-binding
Biological processmRNA processing, mRNA splicing, mRNA transport, Transport
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-72163 mRNA Splicing - Major Pathway
R-MMU-72165 mRNA Splicing - Minor Pathway
R-MMU-72187 mRNA 3'-end processing
R-MMU-73856 RNA Polymerase II Transcription Termination

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/arginine-rich splicing factor 7
Alternative name(s):
Splicing factor, arginine/serine-rich 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Srsf7
Synonyms:Sfrs7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1926232 Srsf7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000819331 – 267Serine/arginine-rich splicing factor 7Add BLAST267

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei53N6-acetyllysine; alternateCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki53Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei61PhosphoserineBy similarity1
Modified residuei192PhosphoserineBy similarity1
Modified residuei194PhosphoserineBy similarity1
Modified residuei196PhosphoserineBy similarity1
Modified residuei210PhosphoserineCombined sources1
Modified residuei212PhosphoserineCombined sources1
Modified residuei221PhosphoserineBy similarity1
Modified residuei223PhosphoserineBy similarity1
Modified residuei225PhosphoserineBy similarity1
Modified residuei260PhosphoserineBy similarity1
Modified residuei262PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Extensively phosphorylated on serine residues in the RS domain.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8BL97

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BL97

PeptideAtlas

More...
PeptideAtlasi
Q8BL97

PRoteomics IDEntifications database

More...
PRIDEi
Q8BL97

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BL97

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BL97

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8BL97

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024097 Expressed in 271 organ(s), highest expression level in telencephalon

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BL97 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BL97 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in large molecular weight complexes containing CCNL1 and the p110 isoforms of either CDC2L1 or CDC2L2.

Interacts with CCNL2 and CPSF6.

Interacts with NXF1 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Tra2aQ6PFR54EBI-913123,EBI-913075

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
230352, 3 interactors

Database of interacting proteins

More...
DIPi
DIP-36580N

Protein interaction database and analysis system

More...
IntActi
Q8BL97, 5 interactors

Molecular INTeraction database

More...
MINTi
Q8BL97

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000070983

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BL97

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 113RRMPROSITE-ProRule annotationAdd BLAST74
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati182 – 18918
Repeati190 – 19728
Repeati198 – 20538
Repeati206 – 21348
Repeati240 – 2475; approximate8
Repeati248 – 2556; approximate8

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni110 – 127Sufficient for interaction with NXF1By similarityAdd BLAST18
Regioni182 – 2556 X 8 AA repeats of R-R-S-R-S-X-S-XAdd BLAST74

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi150 – 267Arg/Ser-rich (RS domain)Add BLAST118

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the splicing factor SR family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri133 – 150CCHC-typePROSITE-ProRule annotationAdd BLAST18

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0107 Eukaryota
ENOG4111N8Y LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00910000144115

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BL97

KEGG Orthology (KO)

More...
KOi
K12896

Identification of Orthologs from Complete Genome Data

More...
OMAi
VERSHGM

Database of Orthologous Groups

More...
OrthoDBi
1533297at2759

TreeFam database of animal gene trees

More...
TreeFami
TF351858

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12646 RRM_SRSF7, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR034651 SRSF7_RRM
IPR001878 Znf_CCHC
IPR036875 Znf_CCHC_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit
SSF57756 SSF57756, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 1 hit
PS50158 ZF_CCHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoforms, lacking all or part of the RS domain, may be involved in modulating Srsf7 function.

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BL97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRSSARGRPL QAATAFFLSL FFFLRRFERG FWLWGGDSET KVYVGNLGTG
60 70 80 90 100
AGKGELERAF SYYGPLRTVW IARNPPGFAF VEFEDPRDAE DAVRGLDGKV
110 120 130 140 150
ICGSRVRVEL STGMPRRSRF DRPPARRPFD PNDRCYECGE KGHYAYDCHR
160 170 180 190 200
YSRRRRSRSR SRSHSRSRGR RYSRSRSRSR GRRSRSASPR RSRSVSLRRS
210 220 230 240 250
RSASLRRSRS GSIIGSRYFQ SRSRSRSRSR SISRPRSSRS KSRSPSPKRS
260
RSPSGSPHRS ASPERMD
Note: No experimental confirmation available.
Length:267
Mass (Da):30,818
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF193FC4C3A7D8C7C
GO
Isoform 2 (identifier: Q8BL97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG

Show »
Length:238
Mass (Da):27,378
Checksum:iCB56364C62C1276F
GO
Isoform 3 (identifier: Q8BL97-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG
     159-186: SRSRSHSRSRGRRYSRSRSRSRGRRSRS → YLINEGMVGILVNQSNSFISKAETSVFL
     187-267: Missing.

Show »
Length:157
Mass (Da):17,890
Checksum:i8095D63D190365FA
GO
Isoform 4 (identifier: Q8BL97-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MRSSARGRPLQAATAFFLSLFFFLRRFERGFWLWGGDS → MSRYGRYGG
     238-249: Missing.

Note: No experimental confirmation available.
Show »
Length:226
Mass (Da):26,023
Checksum:iB077E8D9F0FBDCF8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3Q4L335A0A3Q4L335_MOUSE
MCG17902, isoform CRA_e
Srsf7 mCG_17902
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q4L393A0A3Q4L393_MOUSE
Serine/arginine-rich-splicing facto...
Srsf7
235Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q4EGP0A0A3Q4EGP0_MOUSE
Serine/arginine-rich-splicing facto...
Srsf7
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q4EH04A0A3Q4EH04_MOUSE
MCG17902, isoform CRA_d
Srsf7 mCG_17902
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti155R → T in BAC28058 (PubMed:16141072).Curated1
Sequence conflicti208 – 212SRSGS → FRFGF in AAH14857 (PubMed:15489334).Curated5
Sequence conflicti218 – 220Missing in BAC38650 (PubMed:16141072).Curated3
Sequence conflicti231S → F in AAH14857 (PubMed:15489334).Curated1
Sequence conflicti251R → C in AAH14857 (PubMed:15489334).Curated1
Sequence conflicti258H → P in AAH14857 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0136541 – 38MRSSA…WGGDS → MSRYGRYGG in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_013655159 – 186SRSRS…RRSRS → YLINEGMVGILVNQSNSFIS KAETSVFL in isoform 3. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_013656187 – 267Missing in isoform 3. 2 PublicationsAdd BLAST81
Alternative sequenceiVSP_013657238 – 249Missing in isoform 4. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK032861 mRNA Translation: BAC28058.1
AK045884 mRNA Translation: BAC32521.1
AK082848 mRNA Translation: BAC38650.1
BC014857 mRNA Translation: AAH14857.1
BC025529 mRNA Translation: AAH25529.1
BC027391 mRNA Translation: AAH27391.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28988.1 [Q8BL97-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001182414.1, NM_001195485.1
NP_001182415.1, NM_001195486.1
NP_001182416.1, NM_001195487.1
NP_666195.1, NM_146083.2 [Q8BL97-2]
XP_006524253.1, XM_006524190.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000063417; ENSMUSP00000070983; ENSMUSG00000024097 [Q8BL97-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
225027

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:225027

UCSC genome browser

More...
UCSCi
uc008dqp.1 mouse [Q8BL97-1]
uc008dqt.2 mouse [Q8BL97-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032861 mRNA Translation: BAC28058.1
AK045884 mRNA Translation: BAC32521.1
AK082848 mRNA Translation: BAC38650.1
BC014857 mRNA Translation: AAH14857.1
BC025529 mRNA Translation: AAH25529.1
BC027391 mRNA Translation: AAH27391.1
CCDSiCCDS28988.1 [Q8BL97-2]
RefSeqiNP_001182414.1, NM_001195485.1
NP_001182415.1, NM_001195486.1
NP_001182416.1, NM_001195487.1
NP_666195.1, NM_146083.2 [Q8BL97-2]
XP_006524253.1, XM_006524190.2

3D structure databases

SMRiQ8BL97
ModBaseiSearch...

Protein-protein interaction databases

BioGridi230352, 3 interactors
DIPiDIP-36580N
IntActiQ8BL97, 5 interactors
MINTiQ8BL97
STRINGi10090.ENSMUSP00000070983

PTM databases

iPTMnetiQ8BL97
PhosphoSitePlusiQ8BL97
SwissPalmiQ8BL97

Proteomic databases

jPOSTiQ8BL97
PaxDbiQ8BL97
PeptideAtlasiQ8BL97
PRIDEiQ8BL97

Genome annotation databases

EnsembliENSMUST00000063417; ENSMUSP00000070983; ENSMUSG00000024097 [Q8BL97-2]
GeneIDi225027
KEGGimmu:225027
UCSCiuc008dqp.1 mouse [Q8BL97-1]
uc008dqt.2 mouse [Q8BL97-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6432
MGIiMGI:1926232 Srsf7

Phylogenomic databases

eggNOGiKOG0107 Eukaryota
ENOG4111N8Y LUCA
GeneTreeiENSGT00910000144115
InParanoidiQ8BL97
KOiK12896
OMAiVERSHGM
OrthoDBi1533297at2759
TreeFamiTF351858

Enzyme and pathway databases

ReactomeiR-MMU-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-MMU-72163 mRNA Splicing - Major Pathway
R-MMU-72165 mRNA Splicing - Minor Pathway
R-MMU-72187 mRNA 3'-end processing
R-MMU-73856 RNA Polymerase II Transcription Termination

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Srsf7 mouse

Protein Ontology

More...
PROi
PR:Q8BL97

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024097 Expressed in 271 organ(s), highest expression level in telencephalon
ExpressionAtlasiQ8BL97 baseline and differential
GenevisibleiQ8BL97 MM

Family and domain databases

CDDicd12646 RRM_SRSF7, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR034651 SRSF7_RRM
IPR001878 Znf_CCHC
IPR036875 Znf_CCHC_sf
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
SSF57756 SSF57756, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50158 ZF_CCHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRSF7_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BL97
Secondary accession number(s): Q8BMC6
, Q8BUR2, Q8R2N4, Q8R3E9, Q91YS1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: March 1, 2003
Last modified: May 8, 2019
This is version 146 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again