Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (07 Oct 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Actin-binding LIM protein 2

Gene

Ablim2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi83Zinc 1By similarity1
Metal bindingi86Zinc 1By similarity1
Metal bindingi103Zinc 1By similarity1
Metal bindingi106Zinc 1By similarity1
Metal bindingi109Zinc 2By similarity1
Metal bindingi112Zinc 2By similarity1
Metal bindingi131Zinc 2By similarity1
Metal bindingi134Zinc 2By similarity1
Metal bindingi212Zinc 3By similarity1
Metal bindingi215Zinc 3By similarity1
Metal bindingi232Zinc 3By similarity1
Metal bindingi235Zinc 3By similarity1
Metal bindingi238Zinc 4By similarity1
Metal bindingi241Zinc 4By similarity1
Metal bindingi260Zinc 4By similarity1
Metal bindingi263Zinc 4By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ablim2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2385758, Ablim2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000757001 – 612Actin-binding LIM protein 2Add BLAST612

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei282PhosphoserineBy similarity1
Modified residuei294PhosphoserineCombined sources1
Modified residuei365PhosphoserineBy similarity1
Modified residuei368PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei473PhosphothreonineCombined sources1
Modified residuei477PhosphoserineBy similarity1
Modified residuei579PhosphoserineBy similarity1
Isoform 4 (identifier: Q8BL65-4)
Modified residuei351PhosphoserineCombined sources1
Modified residuei356PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
Q8BL65

PRoteomics IDEntifications database

More...
PRIDEi
Q8BL65

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BL65

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BL65

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8BL65

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain. Highly expressed in caudate/putamen, moderately expressed in the olfactory bulb. In the hippocampus, expressed in the CA1, CA2 and CA3 fields. In the cerebellum, expressed in Purkinje cells.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At 15.5 dpc, predominantly expressed in skeletal muscle tissue, including diaphragm, and to a lesser extent in the central nervous system.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029095, Expressed in superior frontal gyrus and 219 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BL65, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with F-actin and ABRA.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
231091, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q8BL65, 1 interactor

Molecular INTeraction database

More...
MINTi
Q8BL65

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000123525

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8BL65, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q8BL65

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BL65

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 81LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini81 – 141LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST61
Domaini151 – 210LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60
Domaini210 – 270LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST61
Domaini544 – 612HPPROSITE-ProRule annotationAdd BLAST69

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi364 – 412Ser-richAdd BLAST49

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1044, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182850

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001357_12_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BL65

KEGG Orthology (KO)

More...
KOi
K07520

Database of Orthologous Groups

More...
OrthoDBi
192350at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BL65

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.950.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028450, ABLIM2
IPR032402, AbLIM_anchor
IPR003128, Villin_headpiece
IPR036886, Villin_headpiece_dom_sf
IPR001781, Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR24213:SF6, PTHR24213:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16182, AbLIM_anchor, 2 hits
PF00412, LIM, 4 hits
PF02209, VHP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132, LIM, 4 hits
SM00153, VHP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47050, SSF47050, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51089, HP, 1 hit
PS00478, LIM_DOMAIN_1, 4 hits
PS50023, LIM_DOMAIN_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BL65-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAVSQPQAA HAPLEKPAST AILCNTCGNV CKGEVLRVQN KYFHIRCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEHI CTRDYQRLYG TRCFSCDRFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKECM CQKCSPPTLL GNSAHVAQGL
160 170 180 190 200
RSCGGCGLEI KNGQALVALD KHWHLGCFKC KTCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHSKFGI RCDGCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFSEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DKSKETRTSS ESIVSVPASS TSGSPSRVIY
310 320 330 340 350
AKLGDEILDY RDLAALPKNK AIYNIDRPDM ISYSPYISHS AVGDRQSYGE
360 370 380 390 400
GDQDDRSYKQ CRTSSPSSAG SVSLGHYTPT SRSPQHYSRP GSESGRSTPS
410 420 430 440 450
LSVHSDSRPP SSTYQQAPRH FHVPDTGVKD NIYRKPPIYK QHAARRLDVE
460 470 480 490 500
DSSFDQDSRK KTTWLLLKGD ADTRTNSPDL DSQSLSLSSG TDQEPLQRMA
510 520 530 540 550
GDSLYSRFPY SKPDTLPGPR KDGLDLRNAN LAPCGADPDA SWGTREYKIY
560 570 580 590 600
PYDSLIVTNR IRVKLPKDVD RTRLERHLSP EEFQEVFGMS IEEFDRLALW
610
KRNDLKKKAL LF
Length:612
Mass (Da):68,107
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i97FE5A9C049AD455
GO
Isoform 2 (identifier: Q8BL65-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:573
Mass (Da):63,897
Checksum:i961AA78804600F73
GO
Isoform 3 (identifier: Q8BL65-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-390: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:606
Mass (Da):67,499
Checksum:iFA48FAA83FEF32F1
GO
Isoform 4 (identifier: Q8BL65-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-350: E → ESPQLLSPTPTE
     390-390: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:617
Mass (Da):68,650
Checksum:i9E086F5C3C1D3CC8
GO
Isoform 5 (identifier: Q8BL65-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-390: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     507-526: RFPYSKPDTLPGPRKDGLDL → QCQPGPLWSRPGCQLGHARV
     527-612: Missing.

Show »
Length:559
Mass (Da):61,492
Checksum:i8DDA6349B9AF90AB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q4K0E9Q4K0_MOUSE
Actin-binding LIM protein 2
Ablim2
664Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q0W6E9Q0W6_MOUSE
Actin-binding LIM protein 2
Ablim2
607Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z0Y4D3Z0Y4_MOUSE
Actin-binding LIM protein 2
Ablim2
346Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6W6N3F6W6N3_MOUSE
Actin-binding LIM protein 2
Ablim2
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YYR9D3YYR9_MOUSE
Actin-binding LIM protein 2
Ablim2
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6UI99F6UI99_MOUSE
Actin-binding LIM protein 2
Ablim2
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VVW4F6VVW4_MOUSE
Actin-binding LIM protein 2
Ablim2
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7A5C5F7A5C5_MOUSE
Actin-binding LIM protein 2
Ablim2
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YUE1A0A0J9YUE1_MOUSE
Actin-binding LIM protein 2
Ablim2
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti305D → N in BAC32905 (PubMed:16141072).Curated1
Sequence conflicti406D → N in BAC32905 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012120350E → ESPQLLSPTPTE in isoform 4. 1 Publication1
Alternative sequenceiVSP_012121390P → PAGTVSVGTSSCLSLSQHPS PTSVFRHHYIPYFR in isoform 3, isoform 4 and isoform 5. 3 Publications1
Alternative sequenceiVSP_012122507 – 546RFPYS…WGTRE → Q in isoform 2, isoform 3 and isoform 4. 4 PublicationsAdd BLAST40
Alternative sequenceiVSP_012123507 – 526RFPYS…DGLDL → QCQPGPLWSRPGCQLGHARV in isoform 5. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_012124527 – 612Missing in isoform 5. 1 PublicationAdd BLAST86

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ748602 mRNA Translation: CAG38377.1
AJ748603 mRNA Translation: CAG38378.1
AY274116 mRNA Translation: AAP23233.1
AK046243 mRNA Translation: BAC32651.1
AK046879 mRNA Translation: BAC32905.1
AK082707 mRNA Translation: BAC38580.1
BC141125 mRNA Translation: AAI41126.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19235.1 [Q8BL65-1]
CCDS51475.1 [Q8BL65-4]
CCDS51476.1 [Q8BL65-3]
CCDS51477.1 [Q8BL65-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001171168.1, NM_001177697.1 [Q8BL65-4]
NP_001171170.1, NM_001177699.1 [Q8BL65-3]
NP_001171171.1, NM_001177700.1 [Q8BL65-2]
NP_808346.3, NM_177678.7 [Q8BL65-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000054598; ENSMUSP00000050571; ENSMUSG00000029095 [Q8BL65-1]
ENSMUST00000114204; ENSMUSP00000109842; ENSMUSG00000029095 [Q8BL65-3]
ENSMUST00000114205; ENSMUSP00000109843; ENSMUSG00000029095 [Q8BL65-2]
ENSMUST00000114206; ENSMUSP00000109844; ENSMUSG00000029095 [Q8BL65-4]
ENSMUST00000114210; ENSMUSP00000109848; ENSMUSG00000029095 [Q8BL65-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
231148

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:231148

UCSC genome browser

More...
UCSCi
uc008xeg.2, mouse [Q8BL65-1]
uc033iiv.1, mouse [Q8BL65-2]
uc033iiw.1, mouse [Q8BL65-4]
uc033iix.1, mouse [Q8BL65-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ748602 mRNA Translation: CAG38377.1
AJ748603 mRNA Translation: CAG38378.1
AY274116 mRNA Translation: AAP23233.1
AK046243 mRNA Translation: BAC32651.1
AK046879 mRNA Translation: BAC32905.1
AK082707 mRNA Translation: BAC38580.1
BC141125 mRNA Translation: AAI41126.1
CCDSiCCDS19235.1 [Q8BL65-1]
CCDS51475.1 [Q8BL65-4]
CCDS51476.1 [Q8BL65-3]
CCDS51477.1 [Q8BL65-2]
RefSeqiNP_001171168.1, NM_001177697.1 [Q8BL65-4]
NP_001171170.1, NM_001177699.1 [Q8BL65-3]
NP_001171171.1, NM_001177700.1 [Q8BL65-2]
NP_808346.3, NM_177678.7 [Q8BL65-1]

3D structure databases

BMRBiQ8BL65
SMRiQ8BL65
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi231091, 11 interactors
IntActiQ8BL65, 1 interactor
MINTiQ8BL65
STRINGi10090.ENSMUSP00000123525

PTM databases

iPTMnetiQ8BL65
PhosphoSitePlusiQ8BL65
SwissPalmiQ8BL65

Proteomic databases

PeptideAtlasiQ8BL65
PRIDEiQ8BL65

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22725, 42 antibodies

The DNASU plasmid repository

More...
DNASUi
231148

Genome annotation databases

EnsembliENSMUST00000054598; ENSMUSP00000050571; ENSMUSG00000029095 [Q8BL65-1]
ENSMUST00000114204; ENSMUSP00000109842; ENSMUSG00000029095 [Q8BL65-3]
ENSMUST00000114205; ENSMUSP00000109843; ENSMUSG00000029095 [Q8BL65-2]
ENSMUST00000114206; ENSMUSP00000109844; ENSMUSG00000029095 [Q8BL65-4]
ENSMUST00000114210; ENSMUSP00000109848; ENSMUSG00000029095 [Q8BL65-5]
GeneIDi231148
KEGGimmu:231148
UCSCiuc008xeg.2, mouse [Q8BL65-1]
uc033iiv.1, mouse [Q8BL65-2]
uc033iiw.1, mouse [Q8BL65-4]
uc033iix.1, mouse [Q8BL65-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84448
MGIiMGI:2385758, Ablim2

Phylogenomic databases

eggNOGiKOG1044, Eukaryota
GeneTreeiENSGT00950000182850
HOGENOMiCLU_001357_12_3_1
InParanoidiQ8BL65
KOiK07520
OrthoDBi192350at2759
PhylomeDBiQ8BL65

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
231148, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ablim2, mouse

Protein Ontology

More...
PROi
PR:Q8BL65
RNActiQ8BL65, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029095, Expressed in superior frontal gyrus and 219 other tissues
GenevisibleiQ8BL65, MM

Family and domain databases

Gene3Di1.10.950.10, 1 hit
InterProiView protein in InterPro
IPR028450, ABLIM2
IPR032402, AbLIM_anchor
IPR003128, Villin_headpiece
IPR036886, Villin_headpiece_dom_sf
IPR001781, Znf_LIM
PANTHERiPTHR24213:SF6, PTHR24213:SF6, 2 hits
PfamiView protein in Pfam
PF16182, AbLIM_anchor, 2 hits
PF00412, LIM, 4 hits
PF02209, VHP, 1 hit
SMARTiView protein in SMART
SM00132, LIM, 4 hits
SM00153, VHP, 1 hit
SUPFAMiSSF47050, SSF47050, 1 hit
PROSITEiView protein in PROSITE
PS51089, HP, 1 hit
PS00478, LIM_DOMAIN_1, 4 hits
PS50023, LIM_DOMAIN_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABLM2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BL65
Secondary accession number(s): B2RUF8
, Q6H8P8, Q80WK6, Q8BUT1, Q8BXI7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: March 1, 2003
Last modified: October 7, 2020
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again