Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 124 (03 Jul 2019)
Sequence version 2 (29 May 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transport and Golgi organization protein 1 homolog

Gene

Mia3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the transport of cargos that are too large to fit into COPII-coated vesicles and require specific mechanisms to be incorporated into membrane-bound carriers and exported from the endoplasmic reticulum. This protein is required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. It may participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. It is also specifically required for the secretion of lipoproteins by participating in their export from the endoplasmic reticulum. Required for correct assembly of COPII coat components at endoplasmic reticulum exit sites (ERES) and for the localization of SEC16A and membrane-bound ER-resident complexes consisting of MIA2 and PREB/SEC12 to ERES.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, Exocytosis, Protein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-5694530 Cargo concentration in the ER
R-MMU-8957275 Post-translational protein phosphorylation

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.113.1.1 the collagen secretory protein, mia3 (mia3) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transport and Golgi organization protein 1 homologCurated
Short name:
TANGO1Curated
Alternative name(s):
Melanoma inhibitory activity protein 3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mia3Imported
Synonyms:Kiaa0268Imported, Tango1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443183 Mia3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini25 – 1171LumenalSequence analysisAdd BLAST1147
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei1172 – 1192Sequence analysisAdd BLAST21
Topological domaini1193 – 1202LumenalSequence analysis10
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1203 – 1223HelicalSequence analysisAdd BLAST21
Topological domaini1224 – 1930CytoplasmicSequence analysisAdd BLAST707

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000028899925 – 1930Transport and Golgi organization protein 1 homologAdd BLAST1906

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei229PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi360N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi631N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei856PhosphoserineBy similarity1
Modified residuei1458PhosphoserineCombined sources1
Modified residuei1693PhosphoserineCombined sources1
Modified residuei1705PhosphoserineCombined sources1
Modified residuei1733PhosphoserineBy similarity1
Modified residuei1754PhosphoserineCombined sources1
Modified residuei1766PhosphoserineCombined sources1
Modified residuei1770PhosphoserineBy similarity1
Modified residuei1805Asymmetric dimethylarginineCombined sources1
Modified residuei1915PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8BI84

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8BI84

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BI84

PeptideAtlas

More...
PeptideAtlasi
Q8BI84

PRoteomics IDEntifications database

More...
PRIDEi
Q8BI84

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2505

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BI84

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BI84

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Ubiquitously expressed during embryogenesis, starting at 8 dpc.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MIA2.

Interacts (via SH3 domain) with COL7A1.

Interacts with the COPII coat subunits SEC23A, SEC23B and maybe SEC24C. May interact with APOB and MIA2.

Interacts with SEC16A.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
237218, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q8BI84, 3 interactors

Molecular INTeraction database

More...
MINTi
Q8BI84

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000064801

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BI84

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 107SH3PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1238 – 1677Mediates interaction with MIA2By similarityAdd BLAST440
Regioni1776 – 1930Proline-rich domain (PRD); mediates interaction with the COPII coat subunits SEC23A and SEC23BBy similarityAdd BLAST155
Regioni1809 – 1869SEC16A-interacting region (SIR); required for its localization to endoplasmic reticulum exit sites and for its interaction with SEC16ABy similarityAdd BLAST61

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1236 – 1329Sequence analysisAdd BLAST94
Coiled coili1359 – 1422Sequence analysisAdd BLAST64
Coiled coili1514 – 1662Sequence analysisAdd BLAST149

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi317 – 324Poly-Glu8
Compositional biasi693 – 699Poly-Glu7
Compositional biasi1020 – 1110Pro-richAdd BLAST91
Compositional biasi1667 – 1916Pro-richAdd BLAST250

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The proline-rich domain (PRD) contains repeated PPP motifs. A single PPP motif is necessary and sufficient to mediate interaction with the COPII coat subunits SEC23A and SEC23B.By similarity
Although 2 transmembrane domains are predicted, it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MIA/OTOR family. Tango1 subfamily.Curated

Keywords - Domaini

Coiled coil, SH3 domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFUG Eukaryota
ENOG410YVAS LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BI84

Database of Orthologous Groups

More...
OrthoDBi
208382at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BI84

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07653 SH3_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BI84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAPGLLFW LFVLGALWWV PGQSDLSHGR RFSDLKVCGD EECSMLMYRG
60 70 80 90 100
KALEDFTGPD CRFVNFKKGD DVYVYYKLAG GSLELWAGSV EHSFGYFPKD
110 120 130 140 150
LIKVLHKYTE EELHIPADET DFVCFEGGRD DFNSYNVEEL LGSLELEDSV
160 170 180 190 200
PEESKKAEEV SQHREKSPEE SRGRELDPVP EPEAFRADSE DGEGAFSEST
210 220 230 240 250
EGLQGQPSAQ ESHPHTSGPA ANAQGVQSSL DTFEEILHDK LKVPGSESRT
260 270 280 290 300
GNSSPASVER EKTDAYKVLK TEMSLDLKTK FGSTADALVS DDEATRLVTS
310 320 330 340 350
LEDGFDEALD AEYYPMEEEE EVEEDADSSD ELPLLTFSDK DEKVPGKPMI
360 370 380 390 400
EKYLTDKDPN LSEEDKVEPP TWGDAFFSIV TGGEGKPGVV DLERSIEEEE
410 420 430 440 450
DVSVSSSHQR KPQPAAGYTD SEDEGDDLFV EEPKTNDVKD SETDPELVIT
460 470 480 490 500
GEEKDIQESR KGLVQPESQS EDAKSETASA YRLQGSKLNP LSAAEKGRDF
510 520 530 540 550
TLKAVFEKKE NGLKESVIHI SKETLHEDKT REIQRDSLES ELVHRALGSS
560 570 580 590 600
VTENNKPKSL GVAPLLGNNK PDASKDSTEV PDGSVSGPKA GQQEGFLEPG
610 620 630 640 650
LKTQHQPRFS PPEETGPSRE LGGKVPISGR NLSWQQEQDV AAVVGKHANE
660 670 680 690 700
KTGFPEEESR EDGTDAEQAR AIRRPQEAES PEVLSVQPGR PDEEEEEEEG
710 720 730 740 750
DNYPPEGLME DENAVSAQQS RENSPSARDG RSDMNSQVFE KVILGTLNLN
760 770 780 790 800
TEKTKQPANM ILETGQESET TSEEAGDVGK ESGHSVVVDS EESHLADMRA
810 820 830 840 850
QRPSQVHGLR DETAAQTPGS GEAVLSKNPN DLQKDNPEEE LVNTLGLEDP
860 870 880 890 900
GVGEISEGEP EDTKEFGVSE SQGTDAEDLR DDPSRQATPE IPDIVLKSIR
910 920 930 940 950
EDLPIINSFF KDDQQSLHRF LKYFDVRELE GLLEDMSIRL RSAHQNSLPY
960 970 980 990 1000
NMEKVLDKVF RASESRILSM AEKMLDTGVA KNRDLGSKES SPLEEAEVLD
1010 1020 1030 1040 1050
DIQDLIYFVR YQYSGVETAP LVTPPPPEEG WARPGEERQP PQQDSLPQEN
1060 1070 1080 1090 1100
TGDLSVQPPE EPELSDQPVT SVQPPEEPEL SDQPVTSVQP PEEPELSDQP
1110 1120 1130 1140 1150
VTSVQPPEEP ELSDQPVTGY TSTSEVSQKP DTKKDIDLGP VMEGGPVGAG
1160 1170 1180 1190 1200
DVQKQLETIA EEPAAVPPLE SAFGSLYAFI LYLSKMLLAT LPDNVQPGPD
1210 1220 1230 1240 1250
FYGLPWQPVI ITAVLGIVSF AIFSWRTILV VKSRVYQVTE KQISEKLENI
1260 1270 1280 1290 1300
KKENAELMQK LSSYEQKIKE SKKYVQETKK QNMILSDEAV KYKDKIKILE
1310 1320 1330 1340 1350
ETNVSLGDKA KSLRLQLESE REQNVKNQDL ILENKKSIEK LKDVISMNAS
1360 1370 1380 1390 1400
ELSEVQVALN EAKLSEENVK SECHRVQEEN ARLKKKKEQL QQQVEEWSKS
1410 1420 1430 1440 1450
HAELTGQIKS FEKSQEDLEI ALTHKDDNIS ALTNCITQLN RLECELESED
1460 1470 1480 1490 1500
PDKGGNESDD LANGETGGDR SEKIRNRIKQ MMDVSRTQTA VSIVEEDLKL
1510 1520 1530 1540 1550
LQLKLRASMS TKCNLEDQIK KLEDDRSSLQ TAKAGLEDEC KTLRQKVEIL
1560 1570 1580 1590 1600
NELYQQKEMA LQKKLSQEEY ERQDREQRLT AADEKVVLAA EEVKTYKRRI
1610 1620 1630 1640 1650
EEMEEELQKT ERSFKNQIAA HEKKAHDNWL KARAAERAMA EEKREAANLR
1660 1670 1680 1690 1700
HKLLEMTQKM AMRQDEPVIV KPMPGRPNTQ NPPRRGLLSQ NGSFGPSPVS
1710 1720 1730 1740 1750
GGECSPPLPA EPPGRPLSAT LSRRDTPRSE FGSLDRHLPR PRWPSEASGK
1760 1770 1780 1790 1800
HSASDPGPAP VVNSSSRSSS PAKAVDEGKV NMAPKGPPPF PGVPLMGGPV
1810 1820 1830 1840 1850
PPPIRYGPPP QLCGGPFGPR PLPPPFVPGM HPPLGVREYA PGVLPGKRDL
1860 1870 1880 1890 1900
PLDPREFLPG HTPFRPPGSL GPREFFIPGT RLPPPTHGPQ EYPPPPPAVR
1910 1920 1930
DSLPSGPREE AKPASPSSVQ DRSQASKPTP
Length:1,930
Mass (Da):213,675
Last modified:May 29, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7C80FC1260136D7F
GO
Isoform 2 (identifier: Q8BI84-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1232-1239: KSRVYQVT → SKLNYLIT
     1240-1930: Missing.

Note: No experimental confirmation available.
Show »
Length:1,239
Mass (Da):136,350
Checksum:i6E16F9D42ECEFF05
GO
Isoform 3 (identifier: Q8BI84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1149: Missing.
     1150-1186: GDVQKQLETIAEEPAAVPPLESAFGSLYAFILYLSKM → MDSLPATVPAVTASPGDPELLGPLSVLYAALIAKLLE

Show »
Length:781
Mass (Da):86,913
Checksum:iC826E08DDB24AD20
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KMH5J3KMH5_MOUSE
Transport and Golgi organization pr...
Mia3
781Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J2D3A0A0R4J2D3_MOUSE
Transport and Golgi organization pr...
Mia3
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KMG3J3KMG3_MOUSE
Transport and Golgi organization pr...
Mia3
463Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YXE6A0A0A6YXE6_MOUSE
Transport and Golgi organization pr...
Mia3
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YX61A0A0A6YX61_MOUSE
Transport and Golgi organization pr...
Mia3
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0258651 – 1149Missing in isoform 3. 1 PublicationAdd BLAST1149
Alternative sequenceiVSP_0258661150 – 1186GDVQK…YLSKM → MDSLPATVPAVTASPGDPEL LGPLSVLYAALIAKLLE in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0258671232 – 1239KSRVYQVT → SKLNYLIT in isoform 2. 1 Publication8
Alternative sequenceiVSP_0258681240 – 1930Missing in isoform 2. 1 PublicationAdd BLAST691

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK044749 mRNA Translation: BAC32064.1
AK046506 mRNA Translation: BAC32759.1
AK078951 mRNA Translation: BAC37474.1
AK084344 mRNA Translation: BAC39164.1
AK148470 mRNA Translation: BAE28571.1 Different termination.
CAAA01083517 Genomic DNA No translation available.
AK220252 mRNA Translation: BAD90177.1
BC125472 mRNA Translation: AAI25473.1

NCBI Reference Sequences

More...
RefSeqi
NP_796363.2, NM_177389.3 [Q8BI84-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
338366

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:338366

UCSC genome browser

More...
UCSCi
uc008icw.1 mouse [Q8BI84-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK044749 mRNA Translation: BAC32064.1
AK046506 mRNA Translation: BAC32759.1
AK078951 mRNA Translation: BAC37474.1
AK084344 mRNA Translation: BAC39164.1
AK148470 mRNA Translation: BAE28571.1 Different termination.
CAAA01083517 Genomic DNA No translation available.
AK220252 mRNA Translation: BAD90177.1
BC125472 mRNA Translation: AAI25473.1
RefSeqiNP_796363.2, NM_177389.3 [Q8BI84-1]

3D structure databases

SMRiQ8BI84
ModBaseiSearch...

Protein-protein interaction databases

BioGridi237218, 1 interactor
IntActiQ8BI84, 3 interactors
MINTiQ8BI84
STRINGi10090.ENSMUSP00000064801

Protein family/group databases

TCDBi9.B.113.1.1 the collagen secretory protein, mia3 (mia3) family

PTM databases

GlyConnecti2505
iPTMnetiQ8BI84
PhosphoSitePlusiQ8BI84

Proteomic databases

EPDiQ8BI84
jPOSTiQ8BI84
PaxDbiQ8BI84
PeptideAtlasiQ8BI84
PRIDEiQ8BI84

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi338366
KEGGimmu:338366
UCSCiuc008icw.1 mouse [Q8BI84-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
375056
MGIiMGI:2443183 Mia3

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410IFUG Eukaryota
ENOG410YVAS LUCA
InParanoidiQ8BI84
OrthoDBi208382at2759
PhylomeDBiQ8BI84

Enzyme and pathway databases

ReactomeiR-MMU-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-MMU-5694530 Cargo concentration in the ER
R-MMU-8957275 Post-translational protein phosphorylation

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8BI84

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF07653 SH3_2, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTGO1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BI84
Secondary accession number(s): A0JLX8
, Q3UFI9, Q571D7, Q8BJE9, Q8BL31, Q8C5B9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: July 3, 2019
This is version 124 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again