Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (02 Dec 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Coiled-coil domain-containing protein 40

Gene

Ccdc40

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for assembly of dynein regulatory complex (DRC) and inner dynein arm (IDA) complexes, which are responsible for ciliary beat regulation, thereby playing a central role in motility in cilia and flagella. Probably acts together with CCDC39 to form a molecular ruler that determines the 96 nanometer (nm) repeat length and arrangements of components in cilia and flagella. Not required for outer dynein arm complexes assembly. Required for axonemal recruitment of CCDC39.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 40Curated
Alternative name(s):
Protein links1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ccdc40Imported
Synonyms:Lnks1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443893, Ccdc40

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Defects are the cause of the lnks phenotype, a phenotype related to primary ciliary dyskinesia (PCD). PCD is characterized by recurrent respiratory infections, situs inversus and ciliary immotility and hydrocephalus. The length of the cilia projecting from the nodal pit cells in mutants is drastically reduced.1 Publication

Keywords - Diseasei

Ciliopathy, Primary ciliary dyskinesia

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003052511 – 1192Coiled-coil domain-containing protein 40Add BLAST1192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei306PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BI79

PRoteomics IDEntifications database

More...
PRIDEi
Q8BI79

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BI79

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BI79

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in the embryonic node and midline.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000039963, Expressed in metencephalon part of 4th ventricle choroid plexus (mouse) and 115 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BI79, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BI79, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000039463

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8BI79, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BI79

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili308 – 369Sequence analysisAdd BLAST62
Coiled coili425 – 451Sequence analysisAdd BLAST27
Coiled coili581 – 649Sequence analysisAdd BLAST69
Coiled coili733 – 768Sequence analysisAdd BLAST36
Coiled coili830 – 871Sequence analysisAdd BLAST42
Coiled coili919 – 972Sequence analysisAdd BLAST54
Coiled coili1044 – 1118Sequence analysisAdd BLAST75

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CCDC40 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QQ91, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_008826_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BI79

Identification of Orthologs from Complete Genome Data

More...
OMAi
QLLQQWK

Database of Orthologous Groups

More...
OrthoDBi
323186at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BI79

TreeFam database of animal gene trees

More...
TreeFami
TF325559

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037386, CCDC40

The PANTHER Classification System

More...
PANTHERi
PTHR16275, PTHR16275, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BI79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMDAEKVSTD GEAISEGEVG SNGETPPETE VEFIGETAPD TDVEFIGETS
60 70 80 90 100
PGTDVEPTGE SIQETEVESI GEATPGMDVE PIKKTMTELN VESIGEETSE
110 120 130 140 150
TDVDSIRKAL RGIDLESITV AYPPKKAKHR KVRPQAEVES TGRAAPEGEL
160 170 180 190 200
EVSDHEKVEA LLDELDELSE IVSSPEVSYS DISPLEMGED DTNVSATSTD
210 220 230 240 250
TFQQGIYEPI EPIEPTEPPE PAEPPKPAET PEDSTVRAPA HPYQRDFPMG
260 270 280 290 300
ARHRFRLSIM GSLTPSDTDD LPLETDEPPQ QESVQSTPRA LEETRIQFLD
310 320 330 340 350
QVQSLSPEAL LDRATEGSDE AEEEGSQLIV LDPDHPLMIR FQEALKGYLN
360 370 380 390 400
RQMDKLKLDV QELDVATKQT RSQRQELGVN LYGVQQHLAR LQMQLEKSHD
410 420 430 440 450
RHSLVACERR RKEEELQCAR SVYNKTCQTA NEERKKLAAL QTEVESLALH
460 470 480 490 500
LFYMQNIEQD VRDDIQVMKQ VVRKTETEKM HAEVEKKKQD LFVDQLTERS
510 520 530 540 550
HQLEENIALF EAQYLSQAED TRVLKKAVTE AITEIDTIAV EKKRILQQWT
560 570 580 590 600
TSLVGMKHRN EAYKTVMDAL RECQHQVKST DSEIEVCKKS IMQEEEKNEK
610 620 630 640 650
LARLLNRAET EATLVQKMTA QCLSKQEALQ TEFNTYQLAL QDTEEMLNKG
660 670 680 690 700
YVEHSAVLSE LQATRQAFHQ EQELRQKMDM SMVDKLQEQG TSSKMTKYFH
710 720 730 740 750
QLLRKLQKEN TNLVTHLSKI DGDIAQATLD ITNTNCKIDM HKKTLAEMDK
760 770 780 790 800
EVKRFNDLIT NSESEIARRT ILIERKQSLI NFFNKQLEQM VSELGGEEAG
810 820 830 840 850
PLELEIKRLS KLTEEYNTGV AEAQMTWLRL QQELVQVTHE REEQLVSVDQ
860 870 880 890 900
LKKEVHIMEQ KKLRIESKIA HEKKEQKIVS RHMRDLDNDL SKLNMLLDKN
910 920 930 940 950
RCSSEELEQN NIATETEFLR TLKDSERETI QMQEKLMELS EEKATLLNSF
960 970 980 990 1000
MEAEHQIMLW EKKIQLAKEM RSSVDSETGQ TEIRAMKAEI HRMKVRHGQL
1010 1020 1030 1040 1050
LKQQEKMIRD MELAVARRET IVVQAEGQSK IDKKVITKTE FHYQQRELQK
1060 1070 1080 1090 1100
KVREMHKATD DCTNTISELE ETQKFLSSSL QEKQQLLSEM QATTDVLEEE
1110 1120 1130 1140 1150
INQLTALKRQ NLLEIVTLQT RGKHLQAAIE GKYVFLHRNS RSQLMERKRL
1160 1170 1180 1190
SVRLSQLNKV LSSVQEDYPQ YQEVLQSIQQ KIATKLETPE PS
Length:1,192
Mass (Da):136,772
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA3BBC5ABA0183A3A
GO
Isoform 2 (identifier: Q8BI79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEPEDQADGRSQQEGQQSSAEEDSEQQYTEGPEVSPQLEDNGQEIDEGRDPTRSPEEDITTEGGGGSEGEM
     744-810: Missing.

Show »
Length:1,196
Mass (Da):136,663
Checksum:i9B1C9EC4B65443FA
GO
Isoform 3 (identifier: Q8BI79-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEPEDQADGSQQEGQQSSAEEDSEQQYTEGPEVSPQLEDNGQEIDEGRDPTRSPEEDITTEGGGGSEGEM
     1058-1067: ATDDCTNTIS → FIFSLLRVCG
     1068-1192: Missing.

Show »
Length:1,137
Mass (Da):129,847
Checksum:i74B401B280D2F730
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A494BAF9A0A494BAF9_MOUSE
Coiled-coil domain-containing prote...
Ccdc40
1,262Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494BAV6A0A494BAV6_MOUSE
Coiled-coil domain-containing prote...
Ccdc40
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH85159 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti88E → K in AAH85159 (PubMed:15489334).Curated1
Sequence conflicti292E → K in BAC35680 (PubMed:16141072).Curated1
Sequence conflicti803E → Q in BAC35680 (PubMed:16141072).Curated1
Sequence conflicti845L → M in BAC35680 (PubMed:16141072).Curated1
Sequence conflicti866E → Q in BAC35680 (PubMed:16141072).Curated1
Sequence conflicti884R → G in BAC35680 (PubMed:16141072).Curated1
Sequence conflicti940S → A in AAH85159 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0283101M → MAEPEDQADGRSQQEGQQSS AEEDSEQQYTEGPEVSPQLE DNGQEIDEGRDPTRSPEEDI TTEGGGGSEGEM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0283111M → MAEPEDQADGSQQEGQQSSA EEDSEQQYTEGPEVSPQLED NGQEIDEGRDPTRSPEEDIT TEGGGGSEGEM in isoform 3. 1 Publication1
Alternative sequenceiVSP_028312744 – 810Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0283131058 – 1067ATDDCTNTIS → FIFSLLRVCG in isoform 3. 1 Publication10
Alternative sequenceiVSP_0283141068 – 1192Missing in isoform 3. 1 PublicationAdd BLAST125

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK046971 mRNA Translation: BAC32932.1
AK054172 mRNA Translation: BAC35680.1
AL672140 Genomic DNA No translation available.
BC085159 mRNA Translation: AAH85159.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_780639.1, NM_175430.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000053440; ENSMUSP00000062198; ENSMUSG00000039963 [Q8BI79-3]

UCSC genome browser

More...
UCSCi
uc007mqc.1, mouse [Q8BI79-1]
uc007mqe.1, mouse [Q8BI79-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK046971 mRNA Translation: BAC32932.1
AK054172 mRNA Translation: BAC35680.1
AL672140 Genomic DNA No translation available.
BC085159 mRNA Translation: AAH85159.1 Different initiation.
RefSeqiNP_780639.1, NM_175430.4

3D structure databases

SMRiQ8BI79
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000039463

PTM databases

iPTMnetiQ8BI79
PhosphoSitePlusiQ8BI79

Proteomic databases

PaxDbiQ8BI79
PRIDEiQ8BI79

Genome annotation databases

EnsembliENSMUST00000053440; ENSMUSP00000062198; ENSMUSG00000039963 [Q8BI79-3]
UCSCiuc007mqc.1, mouse [Q8BI79-1]
uc007mqe.1, mouse [Q8BI79-3]

Organism-specific databases

MGIiMGI:2443893, Ccdc40

Phylogenomic databases

eggNOGiENOG502QQ91, Eukaryota
HOGENOMiCLU_008826_0_0_1
InParanoidiQ8BI79
OMAiQLLQQWK
OrthoDBi323186at2759
PhylomeDBiQ8BI79
TreeFamiTF325559

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
207607, 4 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ccdc40, mouse

Protein Ontology

More...
PROi
PR:Q8BI79
RNActiQ8BI79, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000039963, Expressed in metencephalon part of 4th ventricle choroid plexus (mouse) and 115 other tissues
ExpressionAtlasiQ8BI79, baseline and differential
GenevisibleiQ8BI79, MM

Family and domain databases

InterProiView protein in InterPro
IPR037386, CCDC40
PANTHERiPTHR16275, PTHR16275, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCD40_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BI79
Secondary accession number(s): A2AFL0, Q5U4C0, Q8BI59
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: March 1, 2003
Last modified: December 2, 2020
This is version 121 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again