Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase RNF38

Gene

Rnf38

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Acts as an E3 ubiquitin-protein ligase able to ubiquitinate p53/TP53 which promotes its relocalization to discrete foci associated with PML nuclear bodies. Exhibits preference for UBE2D2 as a E2 enzyme.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri466 – 507RING-typePROSITE-ProRule annotationAdd BLAST42

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase RNF38 (EC:2.3.2.27)
Alternative name(s):
RING finger protein 38
RING-type E3 ubiquitin transferase RNF38Curated
Gene namesi
Name:Rnf38
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1920719 Rnf38

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000560791 – 518E3 ubiquitin-protein ligase RNF38Add BLAST518

Proteomic databases

PaxDbiQ8BI21
PRIDEiQ8BI21

PTM databases

iPTMnetiQ8BI21
PhosphoSitePlusiQ8BI21

Expressioni

Gene expression databases

BgeeiENSMUSG00000035696 Expressed in 293 organ(s), highest expression level in seminiferous tubule of testis
CleanExiMM_RNF38
ExpressionAtlasiQ8BI21 baseline and differential
GenevisibleiQ8BI21 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000095702

Structurei

3D structure databases

ProteinModelPortaliQ8BI21
SMRiQ8BI21
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi60 – 74Bipartite nuclear localization signal 1By similarityAdd BLAST15
Motifi118 – 133Bipartite nuclear localization signal 2By similarityAdd BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi242 – 407Pro-richAdd BLAST166

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri466 – 507RING-typePROSITE-ProRule annotationAdd BLAST42

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0800 Eukaryota
ENOG41121N2 LUCA
GeneTreeiENSGT00730000110459
HOGENOMiHOG000231638
HOVERGENiHBG059283
InParanoidiQ8BI21
KOiK19041
OMAiRSSQHHF
OrthoDBiEOG091G09VT
PhylomeDBiQ8BI21
TreeFamiTF325756

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF13639 zf-RING_2, 1 hit
SMARTiView protein in SMART
SM00184 RING, 1 hit
PROSITEiView protein in PROSITE
PS50089 ZF_RING_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BI21-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALMSEISP GANSAPLPGH PNKVICERVR LQSLFPLLPS DQNTTIQEDA
60 70 80 90 100
HFKAFFQSED SPSPKRQRLS HSVFDYTSAS PAPSPPMRPW EMTSNRQPPS
110 120 130 140 150
VRPNQHHFSG ERCNTPARNR RSPPVRRQRG RRERLSRHNS ISQDENYHHL
160 170 180 190 200
PYAQQQAIEE PRAFHPPNVS PRLLHPAAHP PQQNAVMVDI HDQLHQGTVP
210 220 230 240 250
VSYTVTTVAP HGLPLCTGQH IPACSTQQVP GCSVVFSGQH LPVCSVPPPM
260 270 280 290 300
LQACSVQHLP VPYAAFPPLI SSDPFLIHPP HLSPHHPPHL PPPGQFVPFQ
310 320 330 340 350
TQQSRSPLQR IENEVELLGE HLQVGSFTYP PSAHPPTLPP SAPLQFLTHD
360 370 380 390 400
PLHQEVSFGV PYPPFMPRRL TGRSRYRSQQ PMPPPPYHPS LLPYVLSMLP
410 420 430 440 450
VPPAVGPTFS FELDVEDGEV ENYEALLNLA ERLGEAKPRG LTKADIEQLP
460 470 480 490 500
SYRFNPSNHQ SEQTLCVVCM CDFESRQLLR VLPCNHEFHA KCVDKWLKGN
510
RTCPICRADA SEVHRDSE
Length:518
Mass (Da):57,999
Last modified:March 1, 2003 - v1
Checksum:i8BBA80CD6079F5E2
GO
Isoform 2 (identifier: Q8BI21-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MAALMSEISPGANSAPLPGHPNKVICERVRLQSLFPLLPSDQNTTIQEDAHFKAFFQ → MRE

Note: No experimental confirmation available.
Show »
Length:464
Mass (Da):52,168
Checksum:iA67EE0DCAC8101A2
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UH35Q3UH35_MOUSE
E3 ubiquitin-protein ligase RNF38
Rnf38 mCG_16453
432Annotation score:
B1AWE8B1AWE8_MOUSE
E3 ubiquitin-protein ligase RNF38
Rnf38
220Annotation score:
B1AWE7B1AWE7_MOUSE
E3 ubiquitin-protein ligase RNF38
Rnf38
187Annotation score:
B1AWE9B1AWE9_MOUSE
E3 ubiquitin-protein ligase RNF38
Rnf38
202Annotation score:
E9Q959E9Q959_MOUSE
E3 ubiquitin-protein ligase RNF38
Rnf38
344Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0122441 – 57MAALM…KAFFQ → MRE in isoform 2. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029650 mRNA Translation: BAC26547.1
BC060730 mRNA Translation: AAH60730.1
BC062976 mRNA Translation: AAH62976.1
CCDSiCCDS18122.1 [Q8BI21-2]
RefSeqiNP_780410.2, NM_175201.5 [Q8BI21-2]
UniGeneiMm.262859

Genome annotation databases

EnsembliENSMUST00000098098; ENSMUSP00000095702; ENSMUSG00000035696 [Q8BI21-2]
GeneIDi73469
KEGGimmu:73469
UCSCiuc008srq.2 mouse [Q8BI21-2]
uc008srs.2 mouse [Q8BI21-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029650 mRNA Translation: BAC26547.1
BC060730 mRNA Translation: AAH60730.1
BC062976 mRNA Translation: AAH62976.1
CCDSiCCDS18122.1 [Q8BI21-2]
RefSeqiNP_780410.2, NM_175201.5 [Q8BI21-2]
UniGeneiMm.262859

3D structure databases

ProteinModelPortaliQ8BI21
SMRiQ8BI21
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000095702

PTM databases

iPTMnetiQ8BI21
PhosphoSitePlusiQ8BI21

Proteomic databases

PaxDbiQ8BI21
PRIDEiQ8BI21

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000098098; ENSMUSP00000095702; ENSMUSG00000035696 [Q8BI21-2]
GeneIDi73469
KEGGimmu:73469
UCSCiuc008srq.2 mouse [Q8BI21-2]
uc008srs.2 mouse [Q8BI21-1]

Organism-specific databases

CTDi152006
MGIiMGI:1920719 Rnf38

Phylogenomic databases

eggNOGiKOG0800 Eukaryota
ENOG41121N2 LUCA
GeneTreeiENSGT00730000110459
HOGENOMiHOG000231638
HOVERGENiHBG059283
InParanoidiQ8BI21
KOiK19041
OMAiRSSQHHF
OrthoDBiEOG091G09VT
PhylomeDBiQ8BI21
TreeFamiTF325756

Enzyme and pathway databases

UniPathwayi
UPA00143

Miscellaneous databases

ChiTaRSiRnf38 mouse
PROiPR:Q8BI21
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000035696 Expressed in 293 organ(s), highest expression level in seminiferous tubule of testis
CleanExiMM_RNF38
ExpressionAtlasiQ8BI21 baseline and differential
GenevisibleiQ8BI21 MM

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF13639 zf-RING_2, 1 hit
SMARTiView protein in SMART
SM00184 RING, 1 hit
PROSITEiView protein in PROSITE
PS50089 ZF_RING_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRNF38_MOUSE
AccessioniPrimary (citable) accession number: Q8BI21
Secondary accession number(s): Q6P5B1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 112 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again