Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Borealin

Gene

Cdca8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-4615885 SUMOylation of DNA replication proteins
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-68877 Mitotic Prometaphase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Borealin
Alternative name(s):
Cell division cycle-associated protein 8
MESrg
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cdca8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1196274 Cdca8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002470761 – 289BorealinAdd BLAST289

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei91Citrulline1 Publication1
Modified residuei94Phosphothreonine; by TTKBy similarity1
Modified residuei106PhosphothreonineCombined sources1
Modified residuei110PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki145Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei175PhosphoserineCombined sources1
Modified residuei198PhosphothreonineBy similarity1
Modified residuei213PhosphothreonineBy similarity1
Modified residuei228PhosphoserineCombined sources1
Modified residuei233PhosphoserineBy similarity1
Modified residuei247PhosphoserineBy similarity1
Modified residuei253PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by TTK, essentially at Thr-94. Phosphorylation (probably by CDK1) promotes targeting of the CPC to centromeric DNA.By similarity
Sumoylated by UBE2I and RANBP2. Desumoylated by SENP3 through the removal of SUMO2 and SUMO3 (By similarity).By similarity
Citrullinated by PADI4.1 Publication

Keywords - PTMi

Citrullination, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8BHX3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BHX3

PeptideAtlas

More...
PeptideAtlasi
Q8BHX3

PRoteomics IDEntifications database

More...
PRIDEi
Q8BHX3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BHX3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BHX3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028873 Expressed in 215 organ(s), highest expression level in bone marrow

CleanEx database of gene expression profiles

More...
CleanExi
MM_CDCA8

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BHX3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BHX3 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May form homooligomers and homodimers. Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB or AURKC; in the complex forms a triple-helix bundle-based subcomplex with INCENP and BIRC5 (By similarity). Interacts with SENP3, UBE2I and RANBP2. Interacts (phosphorylated) with SGO1 and SGO2; the association is dependent on CDK1 (By similarity).By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206490, 20 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-119 Chromosomal passenger complex

Protein interaction database and analysis system

More...
IntActi
Q8BHX3, 23 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000081319

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8BHX3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BHX3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 150Required for interaction with SENP3By similarityAdd BLAST150
Regioni1 – 88Required for centromere localizationBy similarityAdd BLAST88
Regioni1 – 58Required for interaction with INCENPBy similarityAdd BLAST58
Regioni10 – 109Required to form a minimal CPC core complex that localizes to the central spindle and midbody and properly executes the role of the CPC during cytokinesisBy similarityAdd BLAST100
Regioni20 – 78Required for interaction with INCENP and BIRC5By similarityAdd BLAST59

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi125 – 132Poly-Glu8
Compositional biasi133 – 138Poly-Gly6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal region (aa 216-289) represents the dimerization motif.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the borealin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IICJ Eukaryota
ENOG4111N8R LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011115

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080103

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BHX3

KEGG Orthology (KO)

More...
KOi
K11514

Identification of Orthologs from Complete Genome Data

More...
OMAi
MNWLEYF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G167R

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BHX3

TreeFam database of animal gene trees

More...
TreeFami
TF101077

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018851 Borealin_N
IPR018867 Cell_div_borealin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10512 Borealin, 1 hit
PF10444 Nbl1_Borealin_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BHX3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPKKRSSRG TRTNTLRSRK LASFLKDFDR EVQVRTKQIE SDRQTLLKEV
60 70 80 90 100
ENLYNIEILR LPKALQGMKW LDYFALGGNK QALEEAAKAD RDITEINNLT
110 120 130 140 150
AEAIQTPLKS VKKRKVIEVE ESIKEEEEEE EEGGGGGGRT KKSHKNLRSA
160 170 180 190 200
KVKRCLPSKK RTQSIQGRGR SKRLSHDFVT PAMSRLEPSL VKPTPGMTPR
210 220 230 240 250
FDSRVFKTPG LRTPAAKEQV YNISINGSPL ADSKEISLSV PIGGGASLRL
260 270 280
LASDLQRIDI AQLNPEALGN IRKLSSRLAQ ICSSIRTGR
Length:289
Mass (Da):32,214
Last modified:July 25, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3971F9666DA8EEF5
GO
Isoform 2 (identifier: Q8BHX3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     276-289: SRLAQICSSIRTGR → GRVILQHLCASLPRLRNESPLRSRLGKLERQEHLRLQRTQVWLSANMAVHL

Note: No experimental confirmation available.
Show »
Length:326
Mass (Da):36,648
Checksum:i5AB6F6FEFF61A039
GO
Isoform 3 (identifier: Q8BHX3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-162: EEEEGGGGGGRTKKSHKNLRSAKVKRCLPSKKRT → QKRAIRIFDLQKSKDAFHPRREPSPYKEEAEVKG
     163-289: Missing.

Note: No experimental confirmation available.
Show »
Length:162
Mass (Da):18,856
Checksum:i65CEEF398D5C60C1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q2C7E9Q2C7_MOUSE
Borealin
Cdca8
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25L → P in BAB27258 (PubMed:16141072).Curated1
Sequence conflicti136G → E in AAT34966 (Ref. 1) Curated1
Sequence conflicti136G → E in BAC36334 (PubMed:16141072).Curated1
Sequence conflicti153K → E in BAC37258 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019922129 – 162EEEEG…SKKRT → QKRAIRIFDLQKSKDAFHPR REPSPYKEEAEVKG in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_019923163 – 289Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_019924276 – 289SRLAQ…IRTGR → GRVILQHLCASLPRLRNESP LRSRLGKLERQEHLRLQRTQ VWLSANMAVHL in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY550907 mRNA Translation: AAT34966.1
AK003755 mRNA Translation: BAB22980.1
AK010905 mRNA Translation: BAB27258.1
AK020070 mRNA Translation: BAB31983.3
AK076065 mRNA Translation: BAC36158.1
AK076422 mRNA Translation: BAC36334.1
AK077717 mRNA Translation: BAC36977.1
AK077920 mRNA Translation: BAC37063.1
AK078404 mRNA Translation: BAC37258.1
AK082800 mRNA Translation: BAC38627.1
AL606933 Genomic DNA No translation available.
BC068181 mRNA Translation: AAH68181.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18631.1 [Q8BHX3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_080836.3, NM_026560.4 [Q8BHX3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.28038

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000030690; ENSMUSP00000030690; ENSMUSG00000028873 [Q8BHX3-2]
ENSMUST00000084296; ENSMUSP00000081319; ENSMUSG00000028873 [Q8BHX3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
52276

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:52276

UCSC genome browser

More...
UCSCi
uc008urj.2 mouse [Q8BHX3-1]
uc008urk.2 mouse [Q8BHX3-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY550907 mRNA Translation: AAT34966.1
AK003755 mRNA Translation: BAB22980.1
AK010905 mRNA Translation: BAB27258.1
AK020070 mRNA Translation: BAB31983.3
AK076065 mRNA Translation: BAC36158.1
AK076422 mRNA Translation: BAC36334.1
AK077717 mRNA Translation: BAC36977.1
AK077920 mRNA Translation: BAC37063.1
AK078404 mRNA Translation: BAC37258.1
AK082800 mRNA Translation: BAC38627.1
AL606933 Genomic DNA No translation available.
BC068181 mRNA Translation: AAH68181.1
CCDSiCCDS18631.1 [Q8BHX3-1]
RefSeqiNP_080836.3, NM_026560.4 [Q8BHX3-1]
UniGeneiMm.28038

3D structure databases

ProteinModelPortaliQ8BHX3
SMRiQ8BHX3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206490, 20 interactors
ComplexPortaliCPX-119 Chromosomal passenger complex
IntActiQ8BHX3, 23 interactors
STRINGi10090.ENSMUSP00000081319

PTM databases

iPTMnetiQ8BHX3
PhosphoSitePlusiQ8BHX3

Proteomic databases

EPDiQ8BHX3
PaxDbiQ8BHX3
PeptideAtlasiQ8BHX3
PRIDEiQ8BHX3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030690; ENSMUSP00000030690; ENSMUSG00000028873 [Q8BHX3-2]
ENSMUST00000084296; ENSMUSP00000081319; ENSMUSG00000028873 [Q8BHX3-1]
GeneIDi52276
KEGGimmu:52276
UCSCiuc008urj.2 mouse [Q8BHX3-1]
uc008urk.2 mouse [Q8BHX3-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55143
MGIiMGI:1196274 Cdca8

Phylogenomic databases

eggNOGiENOG410IICJ Eukaryota
ENOG4111N8R LUCA
GeneTreeiENSGT00390000011115
HOVERGENiHBG080103
InParanoidiQ8BHX3
KOiK11514
OMAiMNWLEYF
OrthoDBiEOG091G167R
PhylomeDBiQ8BHX3
TreeFamiTF101077

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-4615885 SUMOylation of DNA replication proteins
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-68877 Mitotic Prometaphase

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8BHX3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028873 Expressed in 215 organ(s), highest expression level in bone marrow
CleanExiMM_CDCA8
ExpressionAtlasiQ8BHX3 baseline and differential
GenevisibleiQ8BHX3 MM

Family and domain databases

InterProiView protein in InterPro
IPR018851 Borealin_N
IPR018867 Cell_div_borealin
PfamiView protein in Pfam
PF10512 Borealin, 1 hit
PF10444 Nbl1_Borealin_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBOREA_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BHX3
Secondary accession number(s): B1ARX0
, B1ARX1, Q6NVD3, Q8BHB1, Q8BHQ5, Q8BHQ9, Q9CRN4, Q9CS02, Q9CTF4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: July 25, 2006
Last modified: November 7, 2018
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again