Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q8BHD4 (FRMD3_MOUSE)

Entry version 138 (25 May 2022)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

FERM domain-containing protein 3

Gene

Frmd3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative tumor suppressor gene that may be implicated in the origin and progression of lung cancer.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FERM domain-containing protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Frmd3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2442466, Frmd3

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000049122

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei529 – 549HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003180991 – 595FERM domain-containing protein 3Add BLAST595

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8BHD4

PRoteomics IDEntifications database

More...PRIDEi		Q8BHD4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		267518 [Q8BHD4-1]
267519 [Q8BHD4-2]
267520 [Q8BHD4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8BHD4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8BHD4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000049122, Expressed in midbrain and 132 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8BHD4, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000081514

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8BHD4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q8BHD4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8BHD4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 312FERMPROSITE-ProRule annotationAdd BLAST281

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3530, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158577

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_003623_1_7_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8BHD4

Identification of Orthologs from Complete Genome Data

More...OMAi		CPLRQWM

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8BHD4

TreeFam database of animal gene trees

More...TreeFami		TF343477

Family and domain databases

Conserved Domains Database

More...CDDi		cd14473, FERM_B-lobe, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.80.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019749, Band_41_domain
IPR000798, Ez/rad/moesin-like
IPR014847, FERM-adjacent
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR019747, FERM_CS
IPR000299, FERM_domain
IPR018979, FERM_N
IPR018980, FERM_PH-like_C
IPR011993, PH-like_dom_sf
IPR029071, Ubiquitin-like_domsf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08736, FA, 1 hit
PF09380, FERM_C, 1 hit
PF00373, FERM_M, 1 hit
PF09379, FERM_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00935, BAND41
PR00661, ERMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00295, B41, 1 hit
SM01195, FA, 1 hit
SM01196, FERM_C, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47031, SSF47031, 1 hit
SSF54236, SSF54236, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00660, FERM_1, 1 hit
PS50057, FERM_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8BHD4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFASCHCAPR GRRTMKMIHF RSSSIKSLNQ EMKCTIRLLD DSEVSCHIQR 
        60         70         80         90        100
ETKGQFLIEY ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKSH 
       110        120        130        140        150
PPYTMCFRVK FYPHEPLKIK EELTRYLLYL QIKRDIFHGR LLCSFSDAAY 
       160        170        180        190        200
LGACIVQAEF GDYYPDEHPE NYISEFEIFP KQSQKLERKI MEIHNNELRG 
       210        220        230        240        250
QSPAIAEFNL LLKAHTLETY GVDPHPCKDS RGATAFLGFT AAGFVVFQGN 
       260        270        280        290        300
KRIHLRKWSD VCKLKFEGKT FYVIGSQKEK NAVLAFHTST PAACKHLWKC 
       310        320        330        340        350
GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR 
       360        370        380        390        400
DPPEVHRVNI TQSRSFHSLN KQLIINMEPL QPLLPSPTEQ EEEVPVGEGV 
       410        420        430        440        450
PLPKMDVSEP LIASSPVKGA QCADPPDEEE DRVKEDPLTI SELAYNPSAS 
       460        470        480        490        500
LLPTPVDDDE INMLFDCPSR LELEREDTDS FEELEADENA FLIAEEEELK 
       510        520        530        540        550
EARQALSWSY SILTGHIWVN PLVKSFSRLL VVGLGLLLFV FPLLLLLLES 
       560        570        580        590 
GIDLSFLCEI RQTPEFEQFH YEYYCPLKEW VAGKVNIVLY MLGCS
Length:595
Mass (Da):68,448
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2EB221C15159EE61
GO
Isoform 2 (identifier: Q8BHD4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-595: GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVNIVLYMLGCS → VSMP

Show »
Length:554
Mass (Da):63,546
Checksum:iA2525FCD89FA7924
GO
Isoform 3 (identifier: Q8BHD4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-352: Missing.
     353-356: PEVH → MSVF

Show »
Length:243
Mass (Da):27,473
Checksum:iC11A15FB31F22789
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti405M → V in BAC27827 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0311691 – 352Missing in isoform 3. 1 PublicationAdd BLAST352
Alternative sequenceiVSP_031170353 – 356PEVH → MSVF in isoform 3. 1 Publication4
Alternative sequenceiVSP_031168551 – 595GIDLS…MLGCS → VSMP in isoform 2. CuratedAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK032348 mRNA Translation: BAC27827.1
AK034956 mRNA Translation: BAC28893.1
AK048561 mRNA Translation: BAC33375.1
AK149095 mRNA Translation: BAE28738.1
AL844607 Genomic DNA No translation available.
BX088570 Genomic DNA No translation available.
BX957282 Genomic DNA No translation available.
BC112419 mRNA Translation: AAI12420.1
BC113795 mRNA Translation: AAI13796.1
BC118964 mRNA Translation: AAI18965.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS38789.1 [Q8BHD4-1]
CCDS51212.1 [Q8BHD4-2]

NCBI Reference Sequences

More...RefSeqi		NP_001157204.1, NM_001163732.1 [Q8BHD4-2]
NP_766457.1, NM_172869.4 [Q8BHD4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000084474; ENSMUSP00000081514; ENSMUSG00000049122 [Q8BHD4-1]
ENSMUST00000098006; ENSMUSP00000095615; ENSMUSG00000049122 [Q8BHD4-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		242506

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:242506

UCSC genome browser

More...UCSCi		uc008tjg.2, mouse [Q8BHD4-1]
uc008tjh.2, mouse [Q8BHD4-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032348 mRNA Translation: BAC27827.1
AK034956 mRNA Translation: BAC28893.1
AK048561 mRNA Translation: BAC33375.1
AK149095 mRNA Translation: BAE28738.1
AL844607 Genomic DNA No translation available.
BX088570 Genomic DNA No translation available.
BX957282 Genomic DNA No translation available.
BC112419 mRNA Translation: AAI12420.1
BC113795 mRNA Translation: AAI13796.1
BC118964 mRNA Translation: AAI18965.1
CCDSiCCDS38789.1 [Q8BHD4-1]
CCDS51212.1 [Q8BHD4-2]
RefSeqiNP_001157204.1, NM_001163732.1 [Q8BHD4-2]
NP_766457.1, NM_172869.4 [Q8BHD4-1]

3D structure databases

AlphaFoldDBiQ8BHD4
SMRiQ8BHD4
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000081514

PTM databases

iPTMnetiQ8BHD4
PhosphoSitePlusiQ8BHD4

Proteomic databases

PaxDbiQ8BHD4
PRIDEiQ8BHD4
ProteomicsDBi267518 [Q8BHD4-1]
267519 [Q8BHD4-2]
267520 [Q8BHD4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27519, 134 antibodies from 20 providers

The DNASU plasmid repository

More...DNASUi		242506

Genome annotation databases

EnsembliENSMUST00000084474; ENSMUSP00000081514; ENSMUSG00000049122 [Q8BHD4-1]
ENSMUST00000098006; ENSMUSP00000095615; ENSMUSG00000049122 [Q8BHD4-2]
GeneIDi242506
KEGGimmu:242506
UCSCiuc008tjg.2, mouse [Q8BHD4-1]
uc008tjh.2, mouse [Q8BHD4-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		257019
MGIiMGI:2442466, Frmd3
VEuPathDBiHostDB:ENSMUSG00000049122

Phylogenomic databases

eggNOGiKOG3530, Eukaryota
GeneTreeiENSGT00940000158577
HOGENOMiCLU_003623_1_7_1
InParanoidiQ8BHD4
OMAiCPLRQWM
PhylomeDBiQ8BHD4
TreeFamiTF343477

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		242506, 1 hit in 73 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Frmd3, mouse

Protein Ontology

More...PROi		PR:Q8BHD4
RNActiQ8BHD4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000049122, Expressed in midbrain and 132 other tissues
GenevisibleiQ8BHD4, MM

Family and domain databases

CDDicd14473, FERM_B-lobe, 1 hit
Gene3Di1.20.80.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR019749, Band_41_domain
IPR000798, Ez/rad/moesin-like
IPR014847, FERM-adjacent
IPR014352, FERM/acyl-CoA-bd_prot_sf
IPR035963, FERM_2
IPR019748, FERM_central
IPR019747, FERM_CS
IPR000299, FERM_domain
IPR018979, FERM_N
IPR018980, FERM_PH-like_C
IPR011993, PH-like_dom_sf
IPR029071, Ubiquitin-like_domsf
PfamiView protein in Pfam
PF08736, FA, 1 hit
PF09380, FERM_C, 1 hit
PF00373, FERM_M, 1 hit
PF09379, FERM_N, 1 hit
PRINTSiPR00935, BAND41
PR00661, ERMFAMILY
SMARTiView protein in SMART
SM00295, B41, 1 hit
SM01195, FA, 1 hit
SM01196, FERM_C, 1 hit
SUPFAMiSSF47031, SSF47031, 1 hit
SSF54236, SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS00660, FERM_1, 1 hit
PS50057, FERM_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFRMD3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BHD4
Secondary accession number(s): A2BEJ6
, Q3UF23, Q5SPU0, Q5SPU1, Q8C045
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: March 1, 2003
Last modified: May 25, 2022
This is version 138 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again