Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (02 Jun 2021)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Anoctamin-10

Gene

Ano10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1 (By similarity).

By similarity

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2672351, Stimuli-sensing channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Anoctamin-10
Alternative name(s):
Transmembrane protein 16K
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ano10
Synonyms:Tmem16k
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2143103, Ano10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 207CytoplasmicSequence analysisAdd BLAST207
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei208 – 228HelicalSequence analysisAdd BLAST21
Topological domaini229 – 240ExtracellularSequence analysisAdd BLAST12
Transmembranei241 – 261HelicalSequence analysisAdd BLAST21
Topological domaini262 – 316CytoplasmicSequence analysisAdd BLAST55
Transmembranei317 – 337HelicalSequence analysisAdd BLAST21
Topological domaini338 – 352ExtracellularSequence analysisAdd BLAST15
Transmembranei353 – 373HelicalSequence analysisAdd BLAST21
Topological domaini374 – 400CytoplasmicSequence analysisAdd BLAST27
Transmembranei401 – 421HelicalSequence analysisAdd BLAST21
Topological domaini422 – 500ExtracellularSequence analysisAdd BLAST79
Transmembranei501 – 521HelicalSequence analysisAdd BLAST21
Topological domaini522 – 553CytoplasmicSequence analysisAdd BLAST32
Transmembranei554 – 574HelicalSequence analysisAdd BLAST21
Topological domaini575 – 590ExtracellularSequence analysisAdd BLAST16
Transmembranei591 – 611HelicalSequence analysisAdd BLAST21
Topological domaini612 – 659CytoplasmicSequence analysisAdd BLAST48

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002899581 – 659Anoctamin-10Add BLAST659

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8BH79

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BH79

PeptideAtlas

More...
PeptideAtlasi
Q8BH79

PRoteomics IDEntifications database

More...
PRIDEi
Q8BH79

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
296305 [Q8BH79-1]
296306 [Q8BH79-2]
296307 [Q8BH79-3]
296308 [Q8BH79-4]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BH79

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominant expression seen in epithelial tissues.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected in the mantle layer of the neural tube and in the dorsal root ganglia at 14.5 dpc.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037949, Expressed in interventricular septum and 259 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8BH79, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BH79, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8BH79, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000045214

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8BH79, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8BH79

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2513, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157537

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006685_2_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BH79

Identification of Orthologs from Complete Genome Data

More...
OMAi
YNVQDDI

Database of Orthologous Groups

More...
OrthoDBi
1263362at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BH79

TreeFam database of animal gene trees

More...
TreeFami
TF314265

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007632, Anoctamin
IPR031291, Anoctamin-10

The PANTHER Classification System

More...
PANTHERi
PTHR12308, PTHR12308, 1 hit
PTHR12308:SF40, PTHR12308:SF40, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04547, Anoctamin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BH79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRVTLSTLDT CESSFTPLVV IELAQDVKDE TKEWLKNRII AKKKDGGAQL
60 70 80 90 100
LFRPLLNKYE KETLENQNLY LVGASNVRLL LGAEAVGLVK ECTDAAMRAF
110 120 130 140 150
TYGTRHNFKG FHDNNNDFLT MAECQFIIKH ELENLRARDE KMIPGYPQAK
160 170 180 190 200
LYPGKSLMRR LLTSGIVTQV FPLHDTEALK KLEDTWYTRF ALKYQPIDSI
210 220 230 240 250
RSYFGETIAL YFGFLEYFTF ALIPMAIIGL PYYLFVWEDY DKYVIFASFN
260 270 280 290 300
LIWSTVILEV WKRGCANMTY RWGTLVMKRQ FEEPRPGFHG VLGINSVTGR
310 320 330 340 350
EEPLYSSYKR QLRIYLVSLP FVCLCLYFSL YVMMIYFDME DWALSLHEDS
360 370 380 390 400
GSEWTSLLLY VPSIVYAVVI EIMNRLYRYA AEFLTSWENH RLESAYQNHL
410 420 430 440 450
VLKVLVFNFL NCFASLFYIA FVLKDMKLLR QSLATLLITS QILNQVVESL
460 470 480 490 500
LPYWLQRKYC ARVKRKVQAL KSEVDTTLYE QVLLEKEMGT YLGTFDDYLE
510 520 530 540 550
LFLQFGYVSL FSCVYPLAAA FAVLNNFTEV NSDALKMCRV FKRPFAEPSA
560 570 580 590 600
SIGVWQLAFE TMSVISVVTN CALIGMSPQV NAVFPESKTD LVLIVVAVEH
610 620 630 640 650
ALLALKFILA FAIPDKPRHI QQKLARLEFE SLEALKQQQM KLVAENLKEE

YQEDGKEAT
Length:659
Mass (Da):76,188
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i435D9A08D48F93FC
GO
Isoform 2 (identifier: Q8BH79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-255: Missing.

Show »
Length:601
Mass (Da):69,263
Checksum:iE658580D5467DA5C
GO
Isoform 3 (identifier: Q8BH79-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     600-612: HALLALKFILAFA → VLGLQASFTIGFY
     613-659: Missing.

Show »
Length:612
Mass (Da):70,641
Checksum:iD813258D71D5FB3B
GO
Isoform 4 (identifier: Q8BH79-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     639-659: QMKLVAENLKEEYQEDGKEAT → VRAVCLETLLDYIPLAQAPSHCVSFSMDLSVK

Show »
Length:670
Mass (Da):77,241
Checksum:iCD94C0B3B9BFFB0D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1SS60A0A1L1SS60_MOUSE
Anoctamin
Ano10
498Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SV36A0A1L1SV36_MOUSE
Anoctamin
Ano10
478Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SR14A0A1L1SR14_MOUSE
Anoctamin-10
Ano10
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SRJ0A0A1L1SRJ0_MOUSE
Anoctamin-10
Ano10
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH26421 differs from that shown. Contaminating sequence.Curated
The sequence BAC25927 differs from that shown. Reason: Frameshift.Curated
The sequence BAC37706 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_026034198 – 255Missing in isoform 2. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_026035600 – 612HALLA…ILAFA → VLGLQASFTIGFY in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_026036613 – 659Missing in isoform 3. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_026037639 – 659QMKLV…GKEAT → VRAVCLETLLDYIPLAQAPS HCVSFSMDLSVK in isoform 4. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK028391 mRNA Translation: BAC25927.1 Sequence problems.
AK046091 mRNA Translation: BAC32601.1
AK054163 mRNA Translation: BAC35676.1
AK079622 mRNA Translation: BAC37706.1 Different initiation.
AK080947 mRNA Translation: BAC38086.1
BC002294 mRNA Translation: AAH02294.1
BC026421 mRNA Translation: AAH26421.1 Sequence problems.
BC099688 mRNA Translation: AAH99688.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS23645.1 [Q8BH79-1]
CCDS90687.1 [Q8BH79-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001258802.1, NM_001271873.1 [Q8BH79-2]
NP_598740.1, NM_133979.3 [Q8BH79-1]
XP_011241230.1, XM_011242928.2 [Q8BH79-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042546; ENSMUSP00000045214; ENSMUSG00000037949 [Q8BH79-1]
ENSMUST00000214409; ENSMUSP00000151189; ENSMUSG00000037949 [Q8BH79-2]
ENSMUST00000216670; ENSMUSP00000150161; ENSMUSG00000037949 [Q8BH79-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
102566

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:102566

UCSC genome browser

More...
UCSCi
uc009ser.2, mouse [Q8BH79-1]
uc009ses.2, mouse [Q8BH79-2]
uc009seu.1, mouse [Q8BH79-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028391 mRNA Translation: BAC25927.1 Sequence problems.
AK046091 mRNA Translation: BAC32601.1
AK054163 mRNA Translation: BAC35676.1
AK079622 mRNA Translation: BAC37706.1 Different initiation.
AK080947 mRNA Translation: BAC38086.1
BC002294 mRNA Translation: AAH02294.1
BC026421 mRNA Translation: AAH26421.1 Sequence problems.
BC099688 mRNA Translation: AAH99688.1
CCDSiCCDS23645.1 [Q8BH79-1]
CCDS90687.1 [Q8BH79-2]
RefSeqiNP_001258802.1, NM_001271873.1 [Q8BH79-2]
NP_598740.1, NM_133979.3 [Q8BH79-1]
XP_011241230.1, XM_011242928.2 [Q8BH79-4]

3D structure databases

SMRiQ8BH79
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ8BH79, 1 interactor
STRINGi10090.ENSMUSP00000045214

PTM databases

PhosphoSitePlusiQ8BH79

Proteomic databases

EPDiQ8BH79
PaxDbiQ8BH79
PeptideAtlasiQ8BH79
PRIDEiQ8BH79
ProteomicsDBi296305 [Q8BH79-1]
296306 [Q8BH79-2]
296307 [Q8BH79-3]
296308 [Q8BH79-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29353, 73 antibodies

The DNASU plasmid repository

More...
DNASUi
102566

Genome annotation databases

EnsembliENSMUST00000042546; ENSMUSP00000045214; ENSMUSG00000037949 [Q8BH79-1]
ENSMUST00000214409; ENSMUSP00000151189; ENSMUSG00000037949 [Q8BH79-2]
ENSMUST00000216670; ENSMUSP00000150161; ENSMUSG00000037949 [Q8BH79-3]
GeneIDi102566
KEGGimmu:102566
UCSCiuc009ser.2, mouse [Q8BH79-1]
uc009ses.2, mouse [Q8BH79-2]
uc009seu.1, mouse [Q8BH79-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55129
MGIiMGI:2143103, Ano10

Phylogenomic databases

eggNOGiKOG2513, Eukaryota
GeneTreeiENSGT00940000157537
HOGENOMiCLU_006685_2_3_1
InParanoidiQ8BH79
OMAiYNVQDDI
OrthoDBi1263362at2759
PhylomeDBiQ8BH79
TreeFamiTF314265

Enzyme and pathway databases

ReactomeiR-MMU-2672351, Stimuli-sensing channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
102566, 0 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ano10, mouse

Protein Ontology

More...
PROi
PR:Q8BH79
RNActiQ8BH79, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037949, Expressed in interventricular septum and 259 other tissues
ExpressionAtlasiQ8BH79, baseline and differential
GenevisibleiQ8BH79, MM

Family and domain databases

InterProiView protein in InterPro
IPR007632, Anoctamin
IPR031291, Anoctamin-10
PANTHERiPTHR12308, PTHR12308, 1 hit
PTHR12308:SF40, PTHR12308:SF40, 1 hit
PfamiView protein in Pfam
PF04547, Anoctamin, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANO10_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BH79
Secondary accession number(s): Q4FZD2
, Q8BMS8, Q8BV74, Q8BW67, Q8R0U0, Q99LP0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: March 1, 2003
Last modified: June 2, 2021
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again