Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8BGW0 (THMS1_MOUSE)

Entry version 117 (02 Dec 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Protein THEMIS

Gene

Themis

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell development through T-cell antigen receptor (TCR) signaling and in particular through the regulation of calcium influx and phosphorylation of Erk.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processAdaptive immunity, Immunity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein THEMIS
Alternative name(s):
Grb2-associating protein
Short name:
Gasp
Protein thylex
Thymocyte-expressed molecule involved in selection
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Themis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2443552, Themis

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are viable, are born at the expected Mendelian frequency and present no gross abnormalities. They however display a blockade in late T-cell development with defects in thymocyte selection. The number of transitional CD4+CD8(int) thymocytes as well as CD4+ or CD8+ single-positive thymocytes is lower. Thymocytes show defective positive selection, resulting in fewer mature thymocytes. Negative selection is also impaired. A greater percentage of T-cells have CD4+CD25+Foxp3+ regulatory and CD62L(lo)CD44(hi) memory phenotypes compared to wild-type T-cells.5 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi512T → P: Decreased levels of protein expression in thymocytes. Reduced numbers of CD4 and CD8 single-positive thymocytes as well as reduced numbers of peripheral CD4 and CD8 T-cells. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002523791 – 636Protein THEMISAdd BLAST636

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei586PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Tyr residues quickly after TCR stimulation.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8BGW0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8BGW0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8BGW0

PRoteomics IDEntifications database

More...PRIDEi		Q8BGW0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8BGW0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8BGW0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the thymus and to a lesser extent in the spleen but not detectable in non-lymphoid tissues. Highly expressed in thymocytes between the pre-T-cell antigen receptor (pre-TCR) and positive-selection checkpoints and expressed at low level in mature T-cells (at protein level).4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated by stimulation through the alpha-beta TCR.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000049109, Expressed in thymus and 61 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8BGW0, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PLCG1, ITK, GRB2, and LAT.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

Database of interacting proteins

More...DIPi		DIP-48976N

Protein interaction database and analysis system

More...IntActi		Q8BGW0, 8 interactors

Molecular INTeraction database

More...MINTi		Q8BGW0

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000060129

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8BGW0, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 260CABIT 1Add BLAST260
Regioni261 – 520CABIT 2Add BLAST260

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the themis family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QSJR, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00530000063770

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_022319_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8BGW0

Identification of Orthologs from Complete Genome Data

More...OMAi		KVPVGCQ

Database of Orthologous Groups

More...OrthoDBi		337909at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8BGW0

TreeFam database of animal gene trees

More...TreeFami		TF333479

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025946, CABIT_dom
IPR039671, THEMIS

The PANTHER Classification System

More...PANTHERi		PTHR15215, PTHR15215, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12736, CABIT, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BGW0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALSLEEFVY SLDLRTLPRV LEIQSGIYFE GSVYEMFGNE CCLSTGEVIK 
        60         70         80         90        100
ITGLKIKKMM AEICEGAIGG CESQKPFELP MNFPGLFKVM ADKTPYLSIE 
       110        120        130        140        150
EITRTVNIGP SRLGHPCFYH LKDIKLENLI IKQGEPIRFN SVEEINGETL 
       160        170        180        190        200
VNCGVVRNHQ SHSFTLPLSQ EGEFYECEDE HIYTLKEIVE WKIPKNRTRT 
       210        220        230        240        250
VKLTDFSNKW DSTNPFPEDF YGTLILKPVY EIQGVLKFQK DIVRILPSLD 
       260        270        280        290        300
VEVKDITDSY DANWFLQLLS TDDLFEMTSK EFPVVAEVVE ISQGNHLPQS 
       310        320        330        340        350
ILQREKTIVI HKKYQASRIL ASEIRSNFPK RHFLIPISYK GKFKRRPREF 
       360        370        380        390        400
PTAYDLQIAK SRKETLHVVA TKAFHTLHKE LSPVSVGDQF LVHHSETTEV 
       410        420        430        440        450
VFEGTRKVNV LTCEKVLNKT REDAQLPLYM EGGFVEVIHD KKQYQISELC 
       460        470        480        490        500
TQFCWPFNVK VAVRDLSIKD DILAATPGLQ LEEDITDSYL LISDFANPEE 
       510        520        530        540        550
CWEIPMSRLN MTVRLVNGSS LPADAGLLQV RSFVEEITEE QYYMMRRYES 
       560        570        580        590        600
SLSHPPPRPP KHPSAEEMKL TLLSLAEERT INLPKSLKSH HVDRPKKLPS 
       610        620        630 
DESGQDSRAP VGFQNDVADV ERQKSKHGPL QPQAPL
Length:636
Mass (Da):72,780
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i695B904A539110B8
GO
Isoform 2 (identifier: Q8BGW0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     589-636: SHHVDRPKKLPSDESGQDSRAPVGFQNDVADVERQKSKHGPLQPQAPL → YLSNNKSHDWKPEDDEA

Show »
Length:605
Mass (Da):69,544
Checksum:i7D9703BE19E7B8BE
GO
Isoform 3 (identifier: Q8BGW0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     589-636: SHHVDRPKKLPSDESGQDSRAPVGFQNDVADVERQKSKHGPLQPQAPL → DRTPCCC

Show »
Length:595
Mass (Da):68,293
Checksum:i6C0A52AA822F0D54
GO
Isoform 4 (identifier: Q8BGW0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: Missing.
     589-636: SHHVDRPKKLPSDESGQDSRAPVGFQNDVADVERQKSKHGPLQPQAPL → NSSKLKNIKNNKT

Show »
Length:512
Mass (Da):59,082
Checksum:i5443D1CDDD6D4CA0
GO
Isoform 5 (identifier: Q8BGW0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-262: FQKDIVRILPSLDVEVKDITDSYDA → CKYPLRMLSCVSLHCGIWAREAFRT
     263-636: Missing.

Show »
Length:262
Mass (Da):30,040
Checksum:i81689E5349B81092
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CYT7E0CYT7_MOUSE
Protein THEMIS
Themis
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CY68E0CY68_MOUSE
Protein THEMIS
Themis
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti152N → S in BAE41228 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0209191 – 89Missing in isoform 4. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_020920238 – 262FQKDI…DSYDA → CKYPLRMLSCVSLHCGIWAR EAFRT in isoform 5. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_020921263 – 636Missing in isoform 5. 1 PublicationAdd BLAST374
Alternative sequenceiVSP_020922589 – 636SHHVD…PQAPL → YLSNNKSHDWKPEDDEA in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_020923589 – 636SHHVD…PQAPL → DRTPCCC in isoform 3. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_020924589 – 636SHHVD…PQAPL → NSSKLKNIKNNKT in isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB509340 mRNA Translation: BAH79575.1
AK040594 mRNA Translation: BAC30638.1
AK041386 mRNA Translation: BAC30927.1
AK041562 mRNA Translation: BAC30986.1
AK041622 mRNA Translation: BAC31008.1
AK088136 mRNA Translation: BAC40167.1
AK089077 mRNA Translation: BAC40738.1
AK138701 mRNA Translation: BAE23752.1
AK169558 mRNA Translation: BAE41228.1
CH466540 Genomic DNA Translation: EDL04825.1
BC125486 mRNA Translation: AAI25487.1
BC125488 mRNA Translation: AAI25489.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS23758.1 [Q8BGW0-1]
CCDS87977.1 [Q8BGW0-3]

NCBI Reference Sequences

More...RefSeqi		NP_001292592.1, NM_001305663.1 [Q8BGW0-4]
NP_848781.1, NM_178666.6 [Q8BGW0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000056097; ENSMUSP00000060129; ENSMUSG00000049109 [Q8BGW0-1]
ENSMUST00000060409; ENSMUSP00000055315; ENSMUSG00000049109 [Q8BGW0-2]
ENSMUST00000105516; ENSMUSP00000101155; ENSMUSG00000049109 [Q8BGW0-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		210757

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:210757

UCSC genome browser

More...UCSCi		uc007eso.2, mouse [Q8BGW0-5]
uc007esp.2, mouse [Q8BGW0-1]
uc007esq.2, mouse [Q8BGW0-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB509340 mRNA Translation: BAH79575.1
AK040594 mRNA Translation: BAC30638.1
AK041386 mRNA Translation: BAC30927.1
AK041562 mRNA Translation: BAC30986.1
AK041622 mRNA Translation: BAC31008.1
AK088136 mRNA Translation: BAC40167.1
AK089077 mRNA Translation: BAC40738.1
AK138701 mRNA Translation: BAE23752.1
AK169558 mRNA Translation: BAE41228.1
CH466540 Genomic DNA Translation: EDL04825.1
BC125486 mRNA Translation: AAI25487.1
BC125488 mRNA Translation: AAI25489.1
CCDSiCCDS23758.1 [Q8BGW0-1]
CCDS87977.1 [Q8BGW0-3]
RefSeqiNP_001292592.1, NM_001305663.1 [Q8BGW0-4]
NP_848781.1, NM_178666.6 [Q8BGW0-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

DIPiDIP-48976N
IntActiQ8BGW0, 8 interactors
MINTiQ8BGW0
STRINGi10090.ENSMUSP00000060129

PTM databases

iPTMnetiQ8BGW0
PhosphoSitePlusiQ8BGW0

Proteomic databases

EPDiQ8BGW0
jPOSTiQ8BGW0
PaxDbiQ8BGW0
PRIDEiQ8BGW0

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		49883, 231 antibodies

Genome annotation databases

EnsembliENSMUST00000056097; ENSMUSP00000060129; ENSMUSG00000049109 [Q8BGW0-1]
ENSMUST00000060409; ENSMUSP00000055315; ENSMUSG00000049109 [Q8BGW0-2]
ENSMUST00000105516; ENSMUSP00000101155; ENSMUSG00000049109 [Q8BGW0-3]
GeneIDi210757
KEGGimmu:210757
UCSCiuc007eso.2, mouse [Q8BGW0-5]
uc007esp.2, mouse [Q8BGW0-1]
uc007esq.2, mouse [Q8BGW0-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		387357
MGIiMGI:2443552, Themis

Phylogenomic databases

eggNOGiENOG502QSJR, Eukaryota
GeneTreeiENSGT00530000063770
HOGENOMiCLU_022319_1_0_1
InParanoidiQ8BGW0
OMAiKVPVGCQ
OrthoDBi337909at2759
PhylomeDBiQ8BGW0
TreeFamiTF333479

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		210757, 0 hits in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Themis, mouse

Protein Ontology

More...PROi		PR:Q8BGW0
RNActiQ8BGW0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000049109, Expressed in thymus and 61 other tissues
GenevisibleiQ8BGW0, MM

Family and domain databases

InterProiView protein in InterPro
IPR025946, CABIT_dom
IPR039671, THEMIS
PANTHERiPTHR15215, PTHR15215, 1 hit
PfamiView protein in Pfam
PF12736, CABIT, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTHMS1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BGW0
Secondary accession number(s): Q059Y0
, Q3TEM0, Q3UU76, Q8BGP0, Q8C9S6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: March 1, 2003
Last modified: December 2, 2020
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again