Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (16 Jan 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

PAN2-PAN3 deadenylation complex catalytic subunit Pan2

Gene

Pan2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalytic subunit of the poly(A)-nuclease (PAN) deadenylation complex, one of two cytoplasmic mRNA deadenylases involved in general and miRNA-mediated mRNA turnover. PAN specifically shortens poly(A) tails of RNA and the activity is stimulated by poly(A)-binding protein (PABP). PAN deadenylation is followed by rapid degradation of the shortened mRNA tails by the CCR4-NOT complex. Deadenylated mRNAs are then degraded by two alternative mechanisms, namely exosome-mediated 3'-5' exonucleolytic degradation, or deadenlyation-dependent mRNA decaping and subsequent 5'-3' exonucleolytic degradation by XRN1 (PubMed:16284618). Also acts as an important regulator of the HIF1A-mediated hypoxic response. Required for HIF1A mRNA stability independent of poly(A) tail length regulation (By similarity).UniRule annotation1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationUniRule annotationNote: Binds 2 metal cations per subunit in the catalytic exonuclease domain.UniRule annotation

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Positively regulated by the regulatory subunit PAN3.UniRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi977Divalent metal cation; catalyticUniRule annotation1
Metal bindingi979Divalent metal cation; catalyticUniRule annotation1
Metal bindingi1086Divalent metal cation; catalyticUniRule annotation1
Metal bindingi1138Divalent metal cation; catalyticUniRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionExonuclease, Hydrolase, Nuclease
Biological processmRNA processing
LigandMetal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-429947 Deadenylation of mRNA

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C19.978

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PAN2-PAN3 deadenylation complex catalytic subunit Pan2UniRule annotation (EC:3.1.13.4UniRule annotation)
Alternative name(s):
Inactive ubiquitin carboxyl-terminal hydrolase 52UniRule annotation
PAB1P-dependent poly(A)-specific ribonucleaseUniRule annotation
Poly(A)-nuclease deadenylation complex subunit 2UniRule annotation
Short name:
PAN deadenylation complex subunit 2UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pan2UniRule annotation
Synonyms:Kiaa0710, Usp52
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1918984 Pan2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002805221 – 1200PAN2-PAN3 deadenylation complex catalytic subunit Pan2Add BLAST1200

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei784PhosphoserineCombined sources1
Modified residuei1188PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8BGF7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8BGF7

PeptideAtlas

More...
PeptideAtlasi
Q8BGF7

PRoteomics IDEntifications database

More...
PRIDEi
Q8BGF7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8BGF7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8BGF7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000005682 Expressed in 264 organ(s), highest expression level in secondary oocyte

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8BGF7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a heterotrimer with an asymmetric homodimer of the regulatory subunit PAN3 to form the poly(A)-nuclease (PAN) deadenylation complex (By similarity). Interacts with ZFP36 (PubMed:21078877).UniRule annotation1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
222025, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q8BGF7, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000005825

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8BGF7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati153 – 193WD 1UniRule annotationAdd BLAST41
Repeati195 – 231WD 2UniRule annotationAdd BLAST37
Repeati244 – 280WD 3UniRule annotationAdd BLAST37
Repeati328 – 367WD 4UniRule annotationAdd BLAST40
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini485 – 923USPUniRule annotationAdd BLAST439
Domaini974 – 1146ExonucleaseUniRule annotationAdd BLAST173

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni368 – 484LinkerUniRule annotationAdd BLAST117

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains a pseudo-UCH domain. This ubiquitin C-terminal hydrolase (UCH)-like or ubiquitin specific protease (USP)-like domain is predicted to be catalytically inactive because it lacks the active site catalytic triad characteristic of thiol proteases, with residues at the equivalent structural positions that are incompatible with catalysis, and it cannot bind ubiquitin. It functions as a structural scaffold for intra- and intermolecular interactions in the complex.UniRule annotation
The linker, or PAN3 interaction domain (PID), between the WD40 repeats and the pseudo-UCH domain mediates interaction with PAN3.UniRule annotation

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C19 family. PAN2 subfamily.UniRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1275 Eukaryota
COG0847 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013978

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230585

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG089847

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8BGF7

KEGG Orthology (KO)

More...
KOi
K12571

Identification of Orthologs from Complete Genome Data

More...
OMAi
EEPHLYM

Database of Orthologous Groups

More...
OrthoDBi
128953at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8BGF7

TreeFam database of animal gene trees

More...
TreeFami
TF105657

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
3.30.420.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_03182 PAN2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013520 Exonuclease_RNaseT/DNA_pol3
IPR030843 PAN2
IPR028881 PAN2_dom
IPR038765 Papain_like_cys_pep_sf
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
IPR028889 USP_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00929 RNase_T, 1 hit
PF13423 UCH_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00479 EXOIII, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit
SSF53098 SSF53098, 1 hit
SSF54001 SSF54001, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50235 USP_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8BGF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFEGLDPGL AEFSPAMHST LDPVLDAHLN PSLLQNVELD PEGVALEALP
60 70 80 90 100
VQESVHIMEG VYSELHSVVA EVGVPVSVSH FDLHEEMLWV GSHGGHATSF
110 120 130 140 150
FGPALERYSS FQVNGGDDIR QIQSLENGIL FLTKNNLKYM ARGGLIIFDY
160 170 180 190 200
LLDENEDMHS VLLTDNSTLL VGGLQNHVLE IDLNTVQETQ KYAVETPGVT
210 220 230 240 250
IMRQTNRFFF CGHTSGKVSL RDLRSFKVEH EFDAFSGSLS DFDVHGNLLA
260 270 280 290 300
ACGFSSRLTG LACDRFLKVY DLRMMRAITP LQVHVDPAFL RFIPTYTSRL
310 320 330 340 350
AIISQSGQCQ FCEPTGLANP ADIFHVNPVG PLLMTFDVSA SKQALAFGDS
360 370 380 390 400
EGCVHLWTDS PEPSFNPYSR ETEFALPCLV DSLPPLDWSQ DLLPLSLIPV
410 420 430 440 450
PLTTDALLSD WPAANSAPAP RRAPPVDAEI LRTMKKVGFI GYAPNPRTRL
460 470 480 490 500
RNQIPYRLKE SDHEFDNFSQ VTESPTGREE EPLHTVSKKY RKVTIKYSKL
510 520 530 540 550
GLEDFDFKHY NKTLFAGLEP HIPNAYCNCM IQVLYFLEPV RCLIQNHLCQ
560 570 580 590 600
KEFCLACELG FLFHMLDLSR GDPCQGSNFL RAFRTIPEAS ALGLILADSD
610 620 630 640 650
EASGKGSLAR LIQRWNRFIL TQLHQDMQEL EVPQAYRGAG GSFCSSGDSI
660 670 680 690 700
IGQLFSCEME NCSLCRCGSE TVRASSTLLF TLSYPEDKTG KNYDFAQVLK
710 720 730 740 750
RSICLEQNTQ AWCDNCEKYQ PTIQTRNIRH LPDILVINCE VNSSKEADFW
760 770 780 790 800
RLQAEVAFKI AVKKYGGEMK SKEFALADRK ELRSPEGFLC SSIEELKNVW
810 820 830 840 850
LPFSIRMKMT KNKGLDVCNW ADEHELSSLG APSQWGPARA EEELGVYVYD
860 870 880 890 900
LMATVVHILD SRTGGSLVAH IKVGETYHQR KEGVTHQQWY LFNDFLIEPI
910 920 930 940 950
DKYEAVQFDM NWKVPAILYY VKRNLNSRYN LNIKNPIEAS VLLAEASLAR
960 970 980 990 1000
KQRKTHTTFI PLMLNEMPQV GDLVGLDAEF VTLNEEEAEL RSDGTKSTIK
1010 1020 1030 1040 1050
PSQMSVARIT CVRGQGPNEG IPFIDDYIST QEQVVDYLTQ YSGIKPGDLD
1060 1070 1080 1090 1100
AKISSKHLTT LKSTYLKLRF LIDIGVKFVG HGLQKDFRVI NLMVPKDQVL
1110 1120 1130 1140 1150
DTVYLFHMPR KRMISLRFLA WYFLDLKIQG ETHDSIEDAR TALQLYRKYL
1160 1170 1180 1190 1200
ELSKNGTEPE SFHKVLKGLY EKGRKMDWKV PEPESQTSPK NAAVFSVLAL
Length:1,200
Mass (Da):135,253
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9CE98D3BE9FCE182
GO
Isoform 2 (identifier: Q8BGF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     826-834: Missing.

Show »
Length:1,191
Mass (Da):134,413
Checksum:i7EA787D6AEE01B1B
GO
Isoform 3 (identifier: Q8BGF7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-112: Missing.
     826-834: Missing.

Note: No experimental confirmation available.
Show »
Length:1,173
Mass (Da):132,428
Checksum:iFE2477B2C38DDC95
GO
Isoform 4 (identifier: Q8BGF7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     687-722: DKTGKNYDFAQVLKRSICLEQNTQAWCDNCEKYQPT → GS

Note: No experimental confirmation available.
Show »
Length:1,166
Mass (Da):131,176
Checksum:i7BE7611362D0DC72
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC98006 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti175Q → L in BAE34203 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02375095 – 112Missing in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_023751687 – 722DKTGK…KYQPT → GS in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_023752826 – 834Missing in isoform 2 and isoform 3. 2 Publications9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK129196 Transcribed RNA Translation: BAC98006.2 Different initiation.
AK047887 mRNA Translation: BAC33183.1
AK089001 mRNA Translation: BAC40693.1
AK157800 mRNA Translation: BAE34203.1
BC075686 mRNA Translation: AAH75686.1
BC079841 mRNA Translation: AAH79841.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24271.1 [Q8BGF7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001239255.1, NM_001252326.1 [Q8BGF7-2]
NP_001239256.1, NM_001252327.1 [Q8BGF7-3]
NP_598753.1, NM_133992.3 [Q8BGF7-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.244183
Mm.489673

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000005825; ENSMUSP00000005825; ENSMUSG00000005682 [Q8BGF7-1]
ENSMUST00000218315; ENSMUSP00000151216; ENSMUSG00000005682 [Q8BGF7-2]
ENSMUST00000219721; ENSMUSP00000151874; ENSMUSG00000005682 [Q8BGF7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
103135

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:103135

UCSC genome browser

More...
UCSCi
uc007hme.2 mouse [Q8BGF7-1]
uc007hmf.2 mouse [Q8BGF7-2]
uc007hmg.2 mouse [Q8BGF7-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129196 Transcribed RNA Translation: BAC98006.2 Different initiation.
AK047887 mRNA Translation: BAC33183.1
AK089001 mRNA Translation: BAC40693.1
AK157800 mRNA Translation: BAE34203.1
BC075686 mRNA Translation: AAH75686.1
BC079841 mRNA Translation: AAH79841.1
CCDSiCCDS24271.1 [Q8BGF7-1]
RefSeqiNP_001239255.1, NM_001252326.1 [Q8BGF7-2]
NP_001239256.1, NM_001252327.1 [Q8BGF7-3]
NP_598753.1, NM_133992.3 [Q8BGF7-1]
UniGeneiMm.244183
Mm.489673

3D structure databases

ProteinModelPortaliQ8BGF7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi222025, 1 interactor
IntActiQ8BGF7, 1 interactor
STRINGi10090.ENSMUSP00000005825

Protein family/group databases

MEROPSiC19.978

PTM databases

iPTMnetiQ8BGF7
PhosphoSitePlusiQ8BGF7

Proteomic databases

jPOSTiQ8BGF7
PaxDbiQ8BGF7
PeptideAtlasiQ8BGF7
PRIDEiQ8BGF7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000005825; ENSMUSP00000005825; ENSMUSG00000005682 [Q8BGF7-1]
ENSMUST00000218315; ENSMUSP00000151216; ENSMUSG00000005682 [Q8BGF7-2]
ENSMUST00000219721; ENSMUSP00000151874; ENSMUSG00000005682 [Q8BGF7-3]
GeneIDi103135
KEGGimmu:103135
UCSCiuc007hme.2 mouse [Q8BGF7-1]
uc007hmf.2 mouse [Q8BGF7-2]
uc007hmg.2 mouse [Q8BGF7-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9924
MGIiMGI:1918984 Pan2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1275 Eukaryota
COG0847 LUCA
GeneTreeiENSGT00390000013978
HOGENOMiHOG000230585
HOVERGENiHBG089847
InParanoidiQ8BGF7
KOiK12571
OMAiEEPHLYM
OrthoDBi128953at2759
PhylomeDBiQ8BGF7
TreeFamiTF105657

Enzyme and pathway databases

ReactomeiR-MMU-429947 Deadenylation of mRNA

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Pan2 mouse

Protein Ontology

More...
PROi
PR:Q8BGF7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000005682 Expressed in 264 organ(s), highest expression level in secondary oocyte
GenevisibleiQ8BGF7 MM

Family and domain databases

Gene3Di2.130.10.10, 1 hit
3.30.420.10, 1 hit
HAMAPiMF_03182 PAN2, 1 hit
InterProiView protein in InterPro
IPR013520 Exonuclease_RNaseT/DNA_pol3
IPR030843 PAN2
IPR028881 PAN2_dom
IPR038765 Papain_like_cys_pep_sf
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
IPR028889 USP_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00929 RNase_T, 1 hit
PF13423 UCH_1, 1 hit
SMARTiView protein in SMART
SM00479 EXOIII, 1 hit
SUPFAMiSSF50978 SSF50978, 1 hit
SSF53098 SSF53098, 1 hit
SSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS50235 USP_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAN2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BGF7
Secondary accession number(s): Q3TZK5, Q68FH6, Q6ZQ63
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 1, 2003
Last modified: January 16, 2019
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again