Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8BGD0 (CC014_MOUSE)

Entry version 100 (02 Dec 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Uncharacterized protein C3orf14 homolog

Gene
N/A
Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein C3orf14 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1917937, 3830406C13Rik

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000893891 – 127Uncharacterized protein C3orf14 homologAdd BLAST127

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8BGD0

PeptideAtlas

More...PeptideAtlasi		Q8BGD0

PRoteomics IDEntifications database

More...PRIDEi		Q8BGD0

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8BGD0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000033111, Expressed in pineal body and 281 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8BGD0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8BGD0, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000126960

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8BGD0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8BGD0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S7A9, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000005214

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_188537_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8BGD0

Identification of Orthologs from Complete Genome Data

More...OMAi		IGVENEN

Database of Orthologous Groups

More...OrthoDBi		1643090at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8BGD0

TreeFam database of animal gene trees

More...TreeFami		TF335879

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028006, DUF4570

The PANTHER Classification System

More...PANTHERi		PTHR14286, PTHR14286, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15134, DUF4570, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BGD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASLFTQEIH LSKRHEEILS QRLMLLQKMK NKFGDENTER ASLLQATETA 
        60         70         80         90        100
SRRNLRLLKD IDAAEEAFQT KLIPHPQPSM LSLETRYWAS VEEHIPKWEL 
       110        120 
FLLGRAPYPI GAENQNEVPF VQTEAKL
Length:127
Mass (Da):14,729
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA65C687FE59EB007
GO
Isoform 2 (identifier: Q8BGD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-127: TRYWASVEEHIPKWELFLLGRAPYPIGAENQNEVPFVQTEAKL → GNKKKQ

Show »
Length:90
Mass (Da):10,402
Checksum:i0DDFE329E380F243
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YD50A0A286YD50_MOUSE
RIKEN cDNA 3830406C13 gene
3830406C13Rik
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YD67A0A286YD67_MOUSE
RIKEN cDNA 3830406C13 gene
3830406C13Rik
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YDP6A0A286YDP6_MOUSE
RIKEN cDNA 3830406C13 gene
3830406C13Rik
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YE50A0A286YE50_MOUSE
RIKEN cDNA 3830406C13 gene
3830406C13Rik
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti126K → T in AAH57656 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01459685 – 127TRYWA…TEAKL → GNKKKQ in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK076182 mRNA Translation: BAC36238.1
AK089971 mRNA Translation: BAC41022.1
BC027421 mRNA Translation: AAH27421.1
BC057656 mRNA Translation: AAH57656.1
BC094456 mRNA Translation: AAH94456.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS26817.1 [Q8BGD0-1]
CCDS36805.1 [Q8BGD0-2]

NCBI Reference Sequences

More...RefSeqi		NP_001271312.1, NM_001284383.1 [Q8BGD0-1]
NP_001271313.1, NM_001284384.1 [Q8BGD0-1]
NP_001271314.1, NM_001284385.1 [Q8BGD0-1]
NP_001271315.1, NM_001284386.1
NP_001271316.1, NM_001284387.1
NP_666163.1, NM_146051.3 [Q8BGD0-2]
NP_835277.1, NM_178141.3 [Q8BGD0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000112669; ENSMUSP00000108288; ENSMUSG00000033111 [Q8BGD0-2]
ENSMUST00000163392; ENSMUSP00000126960; ENSMUSG00000033111 [Q8BGD0-1]
ENSMUST00000223631; ENSMUSP00000153352; ENSMUSG00000033111 [Q8BGD0-2]
ENSMUST00000223762; ENSMUSP00000153287; ENSMUSG00000033111 [Q8BGD0-1]
ENSMUST00000223927; ENSMUSP00000153588; ENSMUSG00000033111 [Q8BGD0-2]
ENSMUST00000224389; ENSMUSP00000153430; ENSMUSG00000033111 [Q8BGD0-1]
ENSMUST00000225294; ENSMUSP00000153402; ENSMUSG00000033111 [Q8BGD0-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		218734

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:218734

UCSC genome browser

More...UCSCi		uc007sfo.2, mouse [Q8BGD0-2]
uc007sfp.2, mouse [Q8BGD0-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK076182 mRNA Translation: BAC36238.1
AK089971 mRNA Translation: BAC41022.1
BC027421 mRNA Translation: AAH27421.1
BC057656 mRNA Translation: AAH57656.1
BC094456 mRNA Translation: AAH94456.1
CCDSiCCDS26817.1 [Q8BGD0-1]
CCDS36805.1 [Q8BGD0-2]
RefSeqiNP_001271312.1, NM_001284383.1 [Q8BGD0-1]
NP_001271313.1, NM_001284384.1 [Q8BGD0-1]
NP_001271314.1, NM_001284385.1 [Q8BGD0-1]
NP_001271315.1, NM_001284386.1
NP_001271316.1, NM_001284387.1
NP_666163.1, NM_146051.3 [Q8BGD0-2]
NP_835277.1, NM_178141.3 [Q8BGD0-1]

3D structure databases

SMRiQ8BGD0
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000126960

PTM databases

PhosphoSitePlusiQ8BGD0

Proteomic databases

PaxDbiQ8BGD0
PeptideAtlasiQ8BGD0
PRIDEiQ8BGD0

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		218734

Genome annotation databases

EnsembliENSMUST00000112669; ENSMUSP00000108288; ENSMUSG00000033111 [Q8BGD0-2]
ENSMUST00000163392; ENSMUSP00000126960; ENSMUSG00000033111 [Q8BGD0-1]
ENSMUST00000223631; ENSMUSP00000153352; ENSMUSG00000033111 [Q8BGD0-2]
ENSMUST00000223762; ENSMUSP00000153287; ENSMUSG00000033111 [Q8BGD0-1]
ENSMUST00000223927; ENSMUSP00000153588; ENSMUSG00000033111 [Q8BGD0-2]
ENSMUST00000224389; ENSMUSP00000153430; ENSMUSG00000033111 [Q8BGD0-1]
ENSMUST00000225294; ENSMUSP00000153402; ENSMUSG00000033111 [Q8BGD0-1]
GeneIDi218734
KEGGimmu:218734
UCSCiuc007sfo.2, mouse [Q8BGD0-2]
uc007sfp.2, mouse [Q8BGD0-1]

Organism-specific databases

MGIiMGI:1917937, 3830406C13Rik

Phylogenomic databases

eggNOGiENOG502S7A9, Eukaryota
GeneTreeiENSGT00390000005214
HOGENOMiCLU_188537_0_0_1
InParanoidiQ8BGD0
OMAiIGVENEN
OrthoDBi1643090at2759
PhylomeDBiQ8BGD0
TreeFamiTF335879

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		218734, 0 hits in 17 CRISPR screens

Protein Ontology

More...PROi		PR:Q8BGD0
RNActiQ8BGD0, protein

Gene expression databases

BgeeiENSMUSG00000033111, Expressed in pineal body and 281 other tissues
ExpressionAtlasiQ8BGD0, baseline and differential
GenevisibleiQ8BGD0, MM

Family and domain databases

InterProiView protein in InterPro
IPR028006, DUF4570
PANTHERiPTHR14286, PTHR14286, 1 hit
PfamiView protein in Pfam
PF15134, DUF4570, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC014_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BGD0
Secondary accession number(s): Q6PFA6, Q8R061
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: March 1, 2003
Last modified: December 2, 2020
This is version 100 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again