Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q8BG84 (LAIR1_MOUSE)

Entry version 137 (23 Feb 2022)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Leukocyte-associated immunoglobulin-like receptor 1

Gene

Lair1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. Activation by Tyr phosphorylation results in recruitment and activation of the phosphatases PTPN6 and PTPN11. It also reduces the increase of intracellular calcium evoked by B-cell receptor ligation. May also play its inhibitory role independently of SH2-containing phosphatases. Modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG production while inducing secretion of transforming growth factor beta. Down-regulates also IgG and IgE production in B-cells as well as IL8, IL10 and TNF secretion. Inhibits proliferation and induces apoptosis in myeloid leukemia cell lines as well as prevents nuclear translocation of NF-kappa-B p65 subunit/RELA and phosphorylation of I-kappa-B alpha/CHUK in these cells. Inhibits the differentiation of peripheral blood precursors towards dendritic cells (By similarity).

By similarity1 Publication

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-6798695, Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leukocyte-associated immunoglobulin-like receptor 1
Short name:
LAIR-1
Short name:
mLAIR1
Alternative name(s):
CD_antigen: CD305
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Lair1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:105492, Lair1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000055541

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini22 – 144ExtracellularSequence analysisAdd BLAST123
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei145 – 165HelicalSequence analysisAdd BLAST21
Topological domaini166 – 263CytoplasmicSequence analysisAdd BLAST98

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000025068322 – 263Leukocyte-associated immunoglobulin-like receptor 1Add BLAST242

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi34N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi49 ↔ 99PROSITE-ProRule annotation
Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei228PhosphotyrosineBy similarity1
Modified residuei257PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Tyr-228 and Tyr-257 activates it. May be phosphorylated by LCK (By similarity).By similarity
N-glycosylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8BG84

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8BG84

PRoteomics IDEntifications database

More...PRIDEi		Q8BG84

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		264825 [Q8BG84-1]
264826 [Q8BG84-2]
264828 [Q8BG84-5]
264829 [Q8BG84-6]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8BG84, 2 sites

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8BG84

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lymphoid organs and in cell lines of hemopoietic origin.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000055541, Expressed in bone marrow macrophage and 152 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8BG84, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SH2 domains of tyrosine-protein phosphatases PTPN6 and PTPN11. The interaction with PTPN6 is constitutive.

Interacts with the SH2 domain of CSK. Binds with high affinity to extracellular matrix collagens, the interaction is functionally important (By similarity).

By similarity

Protein-protein interaction databases

Database of interacting proteins

More...DIPi		DIP-61634N

Protein interaction database and analysis system

More...IntActi		Q8BG84, 1 interactor

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000083589

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8BG84, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1263
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8BG84

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 115Ig-like C2-typeAdd BLAST89

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi226 – 231ITIM motif 16
Motifi255 – 260ITIM motif 26

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

ITIM (immunoreceptor tyrosine-based inhibitor motif) motif is a cytoplasmic motif present in 2 copies in the intracellular part of LAIR1. When phosphorylated, ITIM motif can bind the SH2 domain of several SH2-containing phosphatases, leading to down-regulation of cell activation.1 Publication

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502TBGD, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162693

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1712690_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8BG84

Identification of Orthologs from Complete Genome Data

More...OMAi		SHNDHAP

Database of Orthologous Groups

More...OrthoDBi		1481318at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8BG84

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8BG84-1) [UniParc]FASTAAdd to basket
Also known as: mLair-1a

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLHPVILLV LVLCLGWKIN TQEGSLPDIT IFPNSSLMIS QGTFVTVVCS 
        60         70         80         90        100
YSDKHDLYNM VRLEKDGSTF MEKSTEPYKT EDEFEIGPVN ETITGHYSCI 
       110        120        130        140        150
YSKGITWSER SKTLELKVIK ENVIQTPAPG PTSDTSWLKT YSIYIFTVVS 
       160        170        180        190        200
VIFLLCLSAL LFCFLRHRQK KQGLPNNKRQ QQRPEERLNL ATNGLEMTPD 
       210        220        230        240        250
IVADDRLPED RWTETWTPVA GDLQEVTYIQ LDHHSLTQRA VGAVTSQSTD 
       260 
MAESSTYAAI IRH
Length:263
Mass (Da):29,793
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB72D1E170DEF3404
GO
Isoform 2 (identifier: Q8BG84-2) [UniParc]FASTAAdd to basket
Also known as: mLair-1b

The sequence of this isoform differs from the canonical sequence as follows:
     24-133: Missing.

Show »
Length:153
Mass (Da):17,524
Checksum:i366F6A302AC35231
GO
Isoform 3 (identifier: Q8BG84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-56: SLPDITIFPNSSLMISQGTFVTVVCSYSDKHD → ELCLWFLLYPWATLELIMCTWDAWKETLEYFL
     57-263: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:56
Mass (Da):6,701
Checksum:i7DBA62B5CD9DAC98
GO
Isoform 5 (identifier: Q8BG84-5) [UniParc]FASTAAdd to basket
Also known as: mLair-1d

The sequence of this isoform differs from the canonical sequence as follows:
     24-172: Missing.

Show »
Length:114
Mass (Da):12,860
Checksum:i84C686C513D7E57B
GO
Isoform 6 (identifier: Q8BG84-6) [UniParc]FASTAAdd to basket
Also known as: mLair-1e

The sequence of this isoform differs from the canonical sequence as follows:
     134-172: Missing.

Show »
Length:224
Mass (Da):25,128
Checksum:iDF3A2399EEE324DA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G8JL64G8JL64_MOUSE
Leukocyte-associated immunoglobulin...
Lair1
246Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC25505 differs from that shown. Reason: Frameshift.Curated
The sequence BAC31610 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence BAC35674 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti143 – 145IYI → MYM in BAC25505 (PubMed:16141072).Curated3
Sequence conflicti149V → G in BAC25505 (PubMed:16141072).Curated1
Sequence conflicti154L → P in BAC25505 (PubMed:16141072).Curated1
Sequence conflicti263H → R in AAH25901 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02071524 – 172Missing in isoform 5. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_02071624 – 133Missing in isoform 2. 2 PublicationsAdd BLAST110
Alternative sequenceiVSP_02071425 – 56SLPDI…SDKHD → ELCLWFLLYPWATLELIMCT WDAWKETLEYFL in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_02071957 – 263Missing in isoform 3. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_020718134 – 172Missing in isoform 6. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY392763 mRNA Translation: AAR32125.1
AY392764 mRNA Translation: AAR32126.1
AY392765 mRNA Translation: AAR32127.1
AY392766 mRNA Translation: AAR32128.1
AK017222 mRNA Translation: BAC25505.1 Frameshift.
AK033472 mRNA Translation: BAC28306.1
AK038574 mRNA Translation: BAC30051.1
AK043664 mRNA Translation: BAC31610.1 Sequence problems.
AK044465 mRNA Translation: BAC31936.1
AK050281 mRNA Translation: BAC34164.1
AK054158 mRNA Translation: BAC35674.1 Sequence problems.
BC025901 mRNA Translation: AAH25901.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS20729.1 [Q8BG84-2]
CCDS51969.1 [Q8BG84-1]
CCDS80654.1 [Q8BG84-6]
CCDS85202.1 [Q8BG84-5]

NCBI Reference Sequences

More...RefSeqi		NP_001106945.1, NM_001113474.1 [Q8BG84-1]
NP_001289604.1, NM_001302675.1 [Q8BG84-6]
NP_001289605.1, NM_001302676.1
NP_001289606.1, NM_001302677.1 [Q8BG84-5]
NP_001289610.1, NM_001302681.1
NP_001289611.1, NM_001302682.1
NP_001289612.1, NM_001302683.1
NP_848726.1, NM_178611.6 [Q8BG84-2]
XP_006540238.1, XM_006540175.3 [Q8BG84-1]
XP_006540239.1, XM_006540176.3 [Q8BG84-1]
XP_017177847.1, XM_017322358.1 [Q8BG84-2]
XP_017177848.1, XM_017322359.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000068865; ENSMUSP00000070712; ENSMUSG00000055541 [Q8BG84-2]
ENSMUST00000086401; ENSMUSP00000083589; ENSMUSG00000055541 [Q8BG84-1]
ENSMUST00000108600; ENSMUSP00000104241; ENSMUSG00000055541 [Q8BG84-6]
ENSMUST00000131126; ENSMUSP00000121738; ENSMUSG00000055541 [Q8BG84-3]
ENSMUST00000136616; ENSMUSP00000122037; ENSMUSG00000055541 [Q8BG84-3]
ENSMUST00000149395; ENSMUSP00000116800; ENSMUSG00000055541 [Q8BG84-3]
ENSMUST00000205296; ENSMUSP00000145940; ENSMUSG00000055541 [Q8BG84-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		52855

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:52855

UCSC genome browser

More...UCSCi		uc009ews.2, mouse [Q8BG84-2]
uc009ewt.2, mouse [Q8BG84-1]
uc012ewk.1, mouse [Q8BG84-5]
uc012ewl.1, mouse [Q8BG84-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY392763 mRNA Translation: AAR32125.1
AY392764 mRNA Translation: AAR32126.1
AY392765 mRNA Translation: AAR32127.1
AY392766 mRNA Translation: AAR32128.1
AK017222 mRNA Translation: BAC25505.1 Frameshift.
AK033472 mRNA Translation: BAC28306.1
AK038574 mRNA Translation: BAC30051.1
AK043664 mRNA Translation: BAC31610.1 Sequence problems.
AK044465 mRNA Translation: BAC31936.1
AK050281 mRNA Translation: BAC34164.1
AK054158 mRNA Translation: BAC35674.1 Sequence problems.
BC025901 mRNA Translation: AAH25901.1
CCDSiCCDS20729.1 [Q8BG84-2]
CCDS51969.1 [Q8BG84-1]
CCDS80654.1 [Q8BG84-6]
CCDS85202.1 [Q8BG84-5]
RefSeqiNP_001106945.1, NM_001113474.1 [Q8BG84-1]
NP_001289604.1, NM_001302675.1 [Q8BG84-6]
NP_001289605.1, NM_001302676.1
NP_001289606.1, NM_001302677.1 [Q8BG84-5]
NP_001289610.1, NM_001302681.1
NP_001289611.1, NM_001302682.1
NP_001289612.1, NM_001302683.1
NP_848726.1, NM_178611.6 [Q8BG84-2]
XP_006540238.1, XM_006540175.3 [Q8BG84-1]
XP_006540239.1, XM_006540176.3 [Q8BG84-1]
XP_017177847.1, XM_017322358.1 [Q8BG84-2]
XP_017177848.1, XM_017322359.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ESKX-ray1.76A/B/C/D22-121[»]
4ETYX-ray1.90A/B/C/D22-133[»]
SMRiQ8BG84
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

DIPiDIP-61634N
IntActiQ8BG84, 1 interactor
STRINGi10090.ENSMUSP00000083589

PTM databases

GlyGeniQ8BG84, 2 sites
PhosphoSitePlusiQ8BG84

Proteomic databases

MaxQBiQ8BG84
PaxDbiQ8BG84
PRIDEiQ8BG84
ProteomicsDBi264825 [Q8BG84-1]
264826 [Q8BG84-2]
264828 [Q8BG84-5]
264829 [Q8BG84-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2596, 806 antibodies from 37 providers

The DNASU plasmid repository

More...DNASUi		52855

Genome annotation databases

EnsembliENSMUST00000068865; ENSMUSP00000070712; ENSMUSG00000055541 [Q8BG84-2]
ENSMUST00000086401; ENSMUSP00000083589; ENSMUSG00000055541 [Q8BG84-1]
ENSMUST00000108600; ENSMUSP00000104241; ENSMUSG00000055541 [Q8BG84-6]
ENSMUST00000131126; ENSMUSP00000121738; ENSMUSG00000055541 [Q8BG84-3]
ENSMUST00000136616; ENSMUSP00000122037; ENSMUSG00000055541 [Q8BG84-3]
ENSMUST00000149395; ENSMUSP00000116800; ENSMUSG00000055541 [Q8BG84-3]
ENSMUST00000205296; ENSMUSP00000145940; ENSMUSG00000055541 [Q8BG84-5]
GeneIDi52855
KEGGimmu:52855
UCSCiuc009ews.2, mouse [Q8BG84-2]
uc009ewt.2, mouse [Q8BG84-1]
uc012ewk.1, mouse [Q8BG84-5]
uc012ewl.1, mouse [Q8BG84-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3903
MGIiMGI:105492, Lair1
VEuPathDBiHostDB:ENSMUSG00000055541

Phylogenomic databases

eggNOGiENOG502TBGD, Eukaryota
GeneTreeiENSGT00940000162693
HOGENOMiCLU_1712690_0_0_1
InParanoidiQ8BG84
OMAiSHNDHAP
OrthoDBi1481318at2759
PhylomeDBiQ8BG84

Enzyme and pathway databases

ReactomeiR-MMU-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-6798695, Neutrophil degranulation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		52855, 0 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Lair1, mouse

Protein Ontology

More...PROi		PR:Q8BG84
RNActiQ8BG84, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000055541, Expressed in bone marrow macrophage and 152 other tissues
GenevisibleiQ8BG84, MM

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
SUPFAMiSSF48726, SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLAIR1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8BG84
Secondary accession number(s): Q80UN5
, Q8BHB6, Q8BRR6, Q8C6N8, Q8CEP5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: March 1, 2003
Last modified: February 23, 2022
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again