Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mediator of RNA polymerase II transcription subunit 12-like protein

Gene

MED12L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • beta-catenin binding Source: InterPro
  • transcription coactivator activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Repressor
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mediator of RNA polymerase II transcription subunit 12-like protein
Alternative name(s):
Mediator complex subunit 12-like protein
Thyroid hormone receptor-associated-like protein
Trinucleotide repeat-containing gene 11 protein-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MED12L
Synonyms:KIAA1635, TNRC11L, TRALP, TRALPUSH
ORF Names:PRO0314
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000144893.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16050 MED12L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611318 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86YW9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
116931

Open Targets

More...
OpenTargetsi
ENSG00000144893

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134884590

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MED12L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166232934

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003130531 – 2145Mediator of RNA polymerase II transcription subunit 12-like proteinAdd BLAST2145

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei462PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86YW9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86YW9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86YW9

PeptideAtlas

More...
PeptideAtlasi
Q86YW9

PRoteomics IDEntifications database

More...
PRIDEi
Q86YW9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70486
70487 [Q86YW9-2]
70488 [Q86YW9-3]
70489 [Q86YW9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86YW9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86YW9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000144893 Expressed in 92 organ(s), highest expression level in substantia nigra

CleanEx database of gene expression profiles

More...
CleanExi
HS_MED12L

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86YW9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86YW9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036807

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May be a component of the Mediator complex, which is known to be composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125538, 17 interactors

Protein interaction database and analysis system

More...
IntActi
Q86YW9, 10 interactors

Molecular INTeraction database

More...
MINTi
Q86YW9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000417235

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q86YW9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86YW9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1877 – 2134Gln-richAdd BLAST258

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Mediator complex subunit 12 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3598 Eukaryota
ENOG410XP2V LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000037505

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231423

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052447

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86YW9

KEGG Orthology (KO)

More...
KOi
K15162

Identification of Orthologs from Complete Genome Data

More...
OMAi
NKQEAFP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00I6

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86YW9

TreeFam database of animal gene trees

More...
TreeFami
TF324178

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019035 Mediator_Med12
IPR021989 Mediator_Med12_catenin-bd
IPR021990 Mediator_Med12_LCEWAV

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09497 Med12, 1 hit
PF12145 Med12-LCEWAV, 1 hit
PF12144 Med12-PQL, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01281 Med12, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86YW9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAFGLLSYE QRPLKRPRLG PPDVYPQDPK QKEDELTAVN VKQGFNNQPA
60 70 80 90 100
FTGDEHGSAR NIVINPSKIG AYFSSILAEK LKLNTFQDTG KKKPQVNAKD
110 120 130 140 150
NYWLVTARSQ SAIHSWFSDL AGNKPLSILA KKVPILSKKE DVFAYLAKYS
160 170 180 190 200
VPMVRATWLI KMTCAYYSAI SEAKIKKRQA PDPNLEWTQI STRYLREQLA
210 220 230 240 250
KISDFYHMAS STGDGPVPVP PEVEQAMKQW EYNEKLAFHM FQEGMLEKHE
260 270 280 290 300
YLTWILDVLE KIRPMDDDLL KLLLPLMLQY SDEFVQSAYL SRRLAYFCAR
310 320 330 340 350
RLSLLLSDSP NLLAAHSPHM MIGPNNSSIG APSPGPPGPG MSPVQLAFSD
360 370 380 390 400
FLSCAQHGPL VYGLSCMLQT VTLCCPSALV WNYSTNENKS ANPGSPLDLL
410 420 430 440 450
QVAPSSLPMP GGNTAFNQQV RARIYEVEQQ IKQRGRAVEV RWSFDKCQES
460 470 480 490 500
TAGVTISRVL HTLEVLDRHC FDRTDSSNSM ETLYHKIFWA NQNKDNQEVA
510 520 530 540 550
PNDEAVVTLL CEWAVSCKRS GKHRAMAVAK LLEKRQAEIE AERCGESEVL
560 570 580 590 600
DEKESISSSS LAGSSLPVFQ NVLLRFLDTQ APSLSDPNSE CEKVEFVNLV
610 620 630 640 650
LLFCEFIRHD VFSHDAYMCT LISRGDLSVT ASTRPRSPVG ENADEHYSKD
660 670 680 690 700
HDVKMEIFSP MPGESCENAN TSLGRRMSVN CEKLVKREKP RELIFPSNYD
710 720 730 740 750
LLRHLQYATH FPIPLDESSS HECNQRTILL YGVGKERDEA RHQLKKITKD
760 770 780 790 800
ILKILNKKST TETGVGDEGQ KARKNKQETF PTLETVFTKL QLLSYFDQHQ
810 820 830 840 850
VTSQISNNVL EQITSFASGT SYHLPLAHHI QLIFDLMEPA LNINGLIDFA
860 870 880 890 900
IQLLNELSVV EAELLLKSSS LAGSYTTGLC VCIVAVLRRY HSCLILNPDQ
910 920 930 940 950
TAQVFEGLCG VVKHVVNPSE CSSPERCILA YLYDLYVSCS HLRSKFGDLF
960 970 980 990 1000
SSACSKVKQT IYNNVMPANS NLRWDPDFMM DFIENPSARS INYSMLGKIL
1010 1020 1030 1040 1050
SDNAANRYSF VCNTLMNVCM GHQDAGRIND IANFSSELTA CCTVLSSEWL
1060 1070 1080 1090 1100
GVLKALCCSS NHVWGFNDVL CTVDVSDLSF HDSLATFIAI LIARQCFSLE
1110 1120 1130 1140 1150
DVVQHVALPS LLAAACGDAD AEPGARMTCR LLLHLFRAPQ ACFLPQATGK
1160 1170 1180 1190 1200
PFPGIRSSCD RHLLAAAHNS IEVGAVFAVL KAIMMLGDAK IGNNSVSSLK
1210 1220 1230 1240 1250
NDDFTMRGLR CDGNADDIWT ASQNPKSCGK SISIETANLR EYARYVLRTI
1260 1270 1280 1290 1300
CQQEWVGEHC LKEPERLCTD KELILDPVLS NMQAQKLLQL ICYPHGIKEC
1310 1320 1330 1340 1350
TEGDNLQRQH IKRILQNLEQ WTLRQSWLEL QLMIKQCLKD PGSGSVAEMN
1360 1370 1380 1390 1400
NLLDNIAKAT IEVFQQSADL NNSSNSGMSL FNPNSIGSAD TSSTRQNGIK
1410 1420 1430 1440 1450
TFLSSSERRG VWLVAPLIAR LPTSVQGRVL KAAGEELEKG QHLGSSSKKE
1460 1470 1480 1490 1500
RDRQKQKSMS LLSQQPFLSL VLTCLKGQDE QREGLLTSLQ NQVNQILSNW
1510 1520 1530 1540 1550
REERYQDDIK ARQMMHEALQ LRLNLVGGMF DTVQRSTQWT TDWALLLLQI
1560 1570 1580 1590 1600
ITSGTVDMHT NNELFTTVLD MLGVLINGTL ASDLSNASPG GSEENKRAYM
1610 1620 1630 1640 1650
NLVKKLKKEL GDKRSESIDK VRQLLPLPKQ TCDVITCEPM GSLIDTKGNK
1660 1670 1680 1690 1700
IAGFDSIDKK QGLQVSTKQK VSPWDLFEGQ KNPAPLSWAW FGTVRVDRRV
1710 1720 1730 1740 1750
IKYEEQHHLL LYHTHPMPKP RSYYLQPLPL PPEEEEEEPT SPVSQEPERK
1760 1770 1780 1790 1800
SAELSDQGKT TTDEEKKTKG RKRKTKSSSR VDEYPQSNIY RVPPNYSPIS
1810 1820 1830 1840 1850
SQMMHHPQST LWGYNLVGQP QQPGFFLQNQ SLTPGGSRLD PAGSFVPTNT
1860 1870 1880 1890 1900
KQALSNMLQR RSGAMMQPPS LHAITSQQQL IQMKLLQQQQ QQRLLRQAQT
1910 1920 1930 1940 1950
RPFQQGQPGD QAALFAAQAR PSPQLPQYPG LQQAQTMPQG YTMYGTQMPL
1960 1970 1980 1990 2000
QQTSQQQAGS VVLSPSYNSR AYPAAHSNPV LMERLRQIQQ QPSGYVQQQA
2010 2020 2030 2040 2050
SPYLQPLTGS QRLNHQALQQ SPLVGGGIDA VLTSAHPNLP SVPLPQDPMR
2060 2070 2080 2090 2100
PRQPQVRQQQ RLLQMQQPQQ PQPQQPPQPQ QSSQSQSQTL GLQAMQPQQP
2110 2120 2130 2140
LFPRQGLQQT QQQQQTAALV RQLQKQLSSN QPQQGVTPYG HPSHF
Length:2,145
Mass (Da):240,120
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i578F84E1C76004C9
GO
Isoform 2 (identifier: Q86YW9-2) [UniParc]FASTAAdd to basket
Also known as: NOPAR

The sequence of this isoform differs from the canonical sequence as follows:
     716-721: DESSSH → VSHCFS
     722-2145: Missing.

Show »
Length:721
Mass (Da):81,116
Checksum:i145D7B923D068AD5
GO
Isoform 3 (identifier: Q86YW9-3) [UniParc]FASTAAdd to basket
Also known as: NOPAR2

The sequence of this isoform differs from the canonical sequence as follows:
     656-656: E → EEQSIMAHMGIDSGTTNIFDEVDKSDFKTDFGSEFP
     716-721: DESSSH → VSHCFS
     722-2145: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):84,995
Checksum:i3D0F41E8EC5556EF
GO
Isoform 4 (identifier: Q86YW9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     951-951: Missing.

Show »
Length:2,144
Mass (Da):240,032
Checksum:i92D96F83CA8F0A63
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WAE6F8WAE6_HUMAN
Mediator of RNA polymerase II trans...
MED12L
1,809Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4I9H7C4I9_HUMAN
Mediator of RNA polymerase II trans...
MED12L
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF24035 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part and potential poly-A sequence.Curated
The sequence BAB14198 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1088I → T in BAB14198 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_037647401Q → P. Corresponds to variant dbSNP:rs17290219Ensembl.1
Natural variantiVAR_037648464E → K. Corresponds to variant dbSNP:rs3108728Ensembl.1
Natural variantiVAR_037649903Q → H. Corresponds to variant dbSNP:rs2131100Ensembl.1
Natural variantiVAR_0376501210R → Q. Corresponds to variant dbSNP:rs3732765Ensembl.1
Natural variantiVAR_0376511698R → Q. Corresponds to variant dbSNP:rs2276761Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029994656E → EEQSIMAHMGIDSGTTNIFD EVDKSDFKTDFGSEFP in isoform 3. 1 Publication1
Alternative sequenceiVSP_029995716 – 721DESSSH → VSHCFS in isoform 2 and isoform 3. 1 Publication6
Alternative sequenceiVSP_029996722 – 2145Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST1424
Alternative sequenceiVSP_029997951Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF388364 mRNA Translation: AAL09579.1
AF388365 mRNA Translation: AAL09580.1
AF399708 mRNA Translation: AAO38813.1
CH471052 Genomic DNA Translation: EAW78800.1
AB046855 mRNA Translation: BAB13461.1
AK022714 mRNA Translation: BAB14198.1 Different initiation.
AF090917 mRNA Translation: AAF24035.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33876.1 [Q86YW9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_443728.3, NM_053002.5 [Q86YW9-1]
XP_011510692.1, XM_011512390.2 [Q86YW9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.744234

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309237; ENSP00000310760; ENSG00000144893 [Q86YW9-3]
ENST00000422248; ENSP00000403308; ENSG00000144893 [Q86YW9-2]
ENST00000474524; ENSP00000417235; ENSG00000144893 [Q86YW9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
116931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:116931

UCSC genome browser

More...
UCSCi
uc003eyn.3 human [Q86YW9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388364 mRNA Translation: AAL09579.1
AF388365 mRNA Translation: AAL09580.1
AF399708 mRNA Translation: AAO38813.1
CH471052 Genomic DNA Translation: EAW78800.1
AB046855 mRNA Translation: BAB13461.1
AK022714 mRNA Translation: BAB14198.1 Different initiation.
AF090917 mRNA Translation: AAF24035.1 Sequence problems.
CCDSiCCDS33876.1 [Q86YW9-1]
RefSeqiNP_443728.3, NM_053002.5 [Q86YW9-1]
XP_011510692.1, XM_011512390.2 [Q86YW9-1]
UniGeneiHs.744234

3D structure databases

ProteinModelPortaliQ86YW9
SMRiQ86YW9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125538, 17 interactors
IntActiQ86YW9, 10 interactors
MINTiQ86YW9
STRINGi9606.ENSP00000417235

PTM databases

iPTMnetiQ86YW9
PhosphoSitePlusiQ86YW9

Polymorphism and mutation databases

BioMutaiMED12L
DMDMi166232934

Proteomic databases

EPDiQ86YW9
MaxQBiQ86YW9
PaxDbiQ86YW9
PeptideAtlasiQ86YW9
PRIDEiQ86YW9
ProteomicsDBi70486
70487 [Q86YW9-2]
70488 [Q86YW9-3]
70489 [Q86YW9-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
116931
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309237; ENSP00000310760; ENSG00000144893 [Q86YW9-3]
ENST00000422248; ENSP00000403308; ENSG00000144893 [Q86YW9-2]
ENST00000474524; ENSP00000417235; ENSG00000144893 [Q86YW9-1]
GeneIDi116931
KEGGihsa:116931
UCSCiuc003eyn.3 human [Q86YW9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
116931
DisGeNETi116931
EuPathDBiHostDB:ENSG00000144893.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MED12L
HGNCiHGNC:16050 MED12L
HPAiHPA036807
MIMi611318 gene
neXtProtiNX_Q86YW9
OpenTargetsiENSG00000144893
PharmGKBiPA134884590

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3598 Eukaryota
ENOG410XP2V LUCA
GeneTreeiENSGT00440000037505
HOGENOMiHOG000231423
HOVERGENiHBG052447
InParanoidiQ86YW9
KOiK15162
OMAiNKQEAFP
OrthoDBiEOG091G00I6
PhylomeDBiQ86YW9
TreeFamiTF324178

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MED12L human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
116931

Protein Ontology

More...
PROi
PR:Q86YW9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000144893 Expressed in 92 organ(s), highest expression level in substantia nigra
CleanExiHS_MED12L
ExpressionAtlasiQ86YW9 baseline and differential
GenevisibleiQ86YW9 HS

Family and domain databases

InterProiView protein in InterPro
IPR019035 Mediator_Med12
IPR021989 Mediator_Med12_catenin-bd
IPR021990 Mediator_Med12_LCEWAV
PfamiView protein in Pfam
PF09497 Med12, 1 hit
PF12145 Med12-LCEWAV, 1 hit
PF12144 Med12-PQL, 1 hit
SMARTiView protein in SMART
SM01281 Med12, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMD12L_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86YW9
Secondary accession number(s): Q96PC7
, Q96PC8, Q9H9M5, Q9HCD7, Q9UI69
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: November 7, 2018
This is version 118 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again