Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q86YS7 (C2CD5_HUMAN)

Entry version 150 (07 Oct 2020)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

C2 domain-containing protein 5

Gene

C2CD5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for insulin-stimulated glucose transport and glucose transporter SLC2A4/GLUT4 translocation from intracellular glucose storage vesicle (GSV) to the plasma membrane (PM) in adipocytes. Binds phospholipid membranes in a calcium-dependent manner and is necessary for the optimal membrane fusion between SLC2A4/GLUT4 GSV and the PM.1 Publication

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+PROSITE-ProRule annotationNote: Binds 3 Ca2+ ions per C2 domain.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi19Calcium 1PROSITE-ProRule annotation1
Metal bindingi19Calcium 2PROSITE-ProRule annotation1
Metal bindingi26Calcium 1PROSITE-ProRule annotation1
Metal bindingi76Calcium 1PROSITE-ProRule annotation1
Metal bindingi76Calcium 2PROSITE-ProRule annotation1
Metal bindingi78Calcium 1PROSITE-ProRule annotation1
Metal bindingi78Calcium 2PROSITE-ProRule annotation1
Metal bindingi78Calcium 3PROSITE-ProRule annotation1
Metal bindingi81Calcium 3PROSITE-ProRule annotation1
Metal bindingi84Calcium 2PROSITE-ProRule annotation1
Metal bindingi84Calcium 3PROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi13 – 271; low affinityAdd BLAST15
Calcium bindingi75 – 862; high affinityAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandCalcium, Lipid-binding, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q86YS7

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1445148, Translocation of SLC2A4 (GLUT4) to the plasma membrane

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C2 domain-containing protein 5
Alternative name(s):
C2 domain-containing phosphoprotein of 138 kDa
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:C2CD5
Synonyms:CDP138, KIAA0528
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000111731.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:29062, C2CD5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		618044, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q86YS7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi19D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-26; A-76; A-78 and A-84. 1 Publication1
Mutagenesisi26D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-76; A-78 and A-84. 1 Publication1
Mutagenesisi76D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-26; A-78 and A-84. 1 Publication1
Mutagenesisi78D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-26; A-76 and A-84. 1 Publication1
Mutagenesisi84D → A: Reduces calcium-binding, phospholipid membrane-binding and insulin-stimulated SLC2A4/GLUT4 translocation; when associated with A-19; A-26; A-76 and A-78. 1 Publication1
Mutagenesisi197S → A: Inhibits insulin-stimulated AKT2-induced phosphorylation, SLC2A4/GLUT4 translocation to the cell surface and GSV-PM fusion. 1 Publication1
Mutagenesisi200S → A: Does not inhibit insulin-stimulated SLC2A4/GLUT4 translocation. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		9847

Open Targets

More...OpenTargetsi		ENSG00000111731

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA143485515

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q86YS7, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		C2CD5

Domain mapping of disease mutations (DMDM)

More...DMDMi		74750574

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002474501 – 1000C2 domain-containing protein 5Add BLAST1000

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei197Phosphoserine; by PKB/AKT21 Publication1
Modified residuei200Phosphoserine1 Publication1
Modified residuei260PhosphoserineCombined sources1
Modified residuei293PhosphoserineCombined sources1
Modified residuei295PhosphoserineCombined sources1
Modified residuei304PhosphoserineBy similarity1
Modified residuei305PhosphoserineCombined sources1
Modified residuei306PhosphoserineBy similarity1
Modified residuei317PhosphothreonineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei601PhosphothreonineCombined sources1
Modified residuei643PhosphoserineCombined sources1
Modified residuei657PhosphoserineBy similarity1
Modified residuei659PhosphoserineCombined sources1
Modified residuei661PhosphoserineBy similarity1
Modified residuei662PhosphoserineCombined sources1
Modified residuei666PhosphothreonineCombined sources1
Modified residuei671PhosphoserineCombined sources1
Modified residuei807PhosphothreonineCombined sources1
Modified residuei817PhosphoserineBy similarity1
Modified residuei852PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Ser-197 by active myristoylated kinase AKT2; insulin-stimulated phosphorylation by AKT2 regulates SLC2A4/GLUT4 translocation into the plasma membrane.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q86YS7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q86YS7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q86YS7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q86YS7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q86YS7

PeptideAtlas

More...PeptideAtlasi		Q86YS7

PRoteomics IDEntifications database

More...PRIDEi		Q86YS7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25908
26956
4964
70464 [Q86YS7-1]
70465 [Q86YS7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q86YS7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q86YS7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000111731, Expressed in secondary oocyte and 244 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q86YS7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q86YS7, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000111731, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115182, 44 interactors

Protein interaction database and analysis system

More...IntActi		Q86YS7, 32 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000443204

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q86YS7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q86YS7

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 109C2PROSITE-ProRule annotationAdd BLAST109

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C2 domain binds to calcium and membrane lipids.

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1031, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000000212

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_003204_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q86YS7

Identification of Orthologs from Complete Genome Data

More...OMAi		DANKMKY

Database of Orthologous Groups

More...OrthoDBi		266134at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q86YS7

TreeFam database of animal gene trees

More...TreeFami		TF323431

Family and domain databases

Conserved Domains Database

More...CDDi		cd08688, C2_KIAA0528-like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037785, C2_C2CD5
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR038983, C2CD5

The PANTHER Classification System

More...PANTHERi		PTHR37412, PTHR37412, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00168, C2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00239, C2, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50004, C2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86YS7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGKLKVKIV AGRHLPVMDR ASDLTDAFVE VKFGNTTFKT DVYLKSLNPQ 
        60         70         80         90        100
WNSEWFKFEV DDEDLQDEPL QITVLDHDTY SANDAIGKVY IDIDPLLYSE 
       110        120        130        140        150
AATVISGWFP IYDTIHGIRG EINVVVKVDL FNDLNRFRQS SCGVKFFCTT 
       160        170        180        190        200
SIPKCYRAVI IHGFVEELVV NEDPEYQWID RIRTPRASNE ARQRLISLMS 
       210        220        230        240        250
GELQRKIGLK VLEMRGNAVV GYLQCFDLEG ESGLVVRAIG TACTLDKLSS 
       260        270        280        290        300
PAAFLPACNS PSKEMKEIPF NEDPNPNTHS SGPSTPLKNQ TYSFSPSKSY 
       310        320        330        340        350
SRQSSSSDTD LSLTPKTGMG SGSAGKEGGP FKALLRQQTQ SALEQREFPF 
       360        370        380        390        400
FTLTAFPPGF LVHVGGVVSA RSVKLLDRIH NPDEPETRDA WWAEIRQEIK 
       410        420        430        440        450
SHAKALGCHA VVGYSESTSI CEEVCILSAS GTAAVLNPRF LQDGTVEGCL 
       460        470        480        490        500
EQRLEENLPT RCGFCHIPYD ELNMPFPAHL TYCYNCRKQK VPDVLFTTID 
       510        520        530        540        550
LPTDATVIGK GCLIQARLCR LKKKAQAEAN ATAISNLLPF MEYEVHTQLM 
       560        570        580        590        600
NKLKLKGMNA LFGLRIQITV GENMLMGLAS ATGVYLAALP TPGGIQIAGK 
       610        620        630        640        650
TPNDGSYEQH ISHMQKKIND TIAKNKELYE INPPEISEEI IGSPIPEPRQ 
       660        670        680        690        700
RSRLLRSQSE SSDEVTELDL SHGKKDAFVL EIDDTDAMED VHSLLTDVPP 
       710        720        730        740        750
PSGFYSCNTE IMPGINNWTS EIQMFTSVRV IRLSSLNLTN QALNKNFNDL 
       760        770        780        790        800
CENLLKSLYF KLRSMIPCCL CHVNFTVSLP EDELIQVTVT AVAITFDKNQ 
       810        820        830        840        850
ALQTTKTPVE KSLQRASTDN EELLQFPLEL CSDSLPSHPF PPAKAMTVEK 
       860        870        880        890        900
ASPVGDGNFR NRSAPPCANS TVGVVKMTPL SFIPGAKITK YLGIINMFFI 
       910        920        930        940        950
RETTSLREEG GVSGFLHAFI AEVFAMVRAH VAALGGNAVV SYIMKQCVFM 
       960        970        980        990       1000
ENPNKNQAQC LINVSGDAVV FVRESDLEVV SSQQPTTNCQ SSCTEGEVTT
Length:1,000
Mass (Da):110,447
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7C51961F54CBBACD
GO
Isoform 2 (identifier: Q86YS7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-316: IPFNEDPNPN...SDTDLSLTPK → SPLVHPPSHG...FSVSVPTLIY
     845-845: A → EHLESASSNSGIPAAQRATSVDYSSFADRCSSWIELIKLKAQTIRRGSIKTT

Show »
Length:1,042
Mass (Da):114,994
Checksum:i23C91754C1A61236
GO
Isoform 3 (identifier: Q86YS7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     845-845: A → EHLESASSNSGIPAAQRATSVDYSSFADRCSSWIELIKLKAQTIRRGSIKTT

Show »
Length:1,051
Mass (Da):116,027
Checksum:i2C4D059D41F01BE8
GO
Isoform 4 (identifier: Q86YS7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-316: IPFNEDPNPN...SDTDLSLTPK → SPLVHPPSHG...FSVSVPTLIY
     345-345: Q → QRGGSPHRFCRR
     845-845: A → EHLESASSNSGIPAAQRATSVDYSSFADRCSSWIELIKLKAQTIRRGSIKTT

Show »
Length:1,053
Mass (Da):116,305
Checksum:iF27416DC231838AA
GO
Isoform 5 (identifier: Q86YS7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-316: IPFNEDPNPN...SDTDLSLTPK → SPLVHPPSHG...FSVSVPTLIY
     382-382: P → PAFVGIMGNTRSYKLLDWNSFNS
     845-845: A → EHLESASSNSGIPAAQRDRCSSWIELIKLKAQTIRRGSIKTT

Show »
Length:1,054
Mass (Da):116,468
Checksum:i2514DE8DDDBDB3A7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YGU7H0YGU7_HUMAN
C2 domain-containing protein 5
C2CD5
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFE9H0YFE9_HUMAN
C2 domain-containing protein 5
C2CD5
165Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFC4H0YFC4_HUMAN
C2 domain-containing protein 5
C2CD5
283Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA25454 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAG58665 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti997E → G in BAG58665 (PubMed:14702039).Curated1
Isoform 4 (identifier: Q86YS7-4)
Sequence conflicti895I → F in AAI43879 (PubMed:15489334).Curated1
Isoform 5 (identifier: Q86YS7-5)
Sequence conflicti895S → P in BAG58665 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028255268 – 316IPFNE…SLTPK → SPLVHPPSHGCRSTHNSPIH TATGSRLTQNFSVSVPTLIY in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_055638345Q → QRGGSPHRFCRR in isoform 4. 1 Publication1
Alternative sequenceiVSP_055639382P → PAFVGIMGNTRSYKLLDWNS FNS in isoform 5. 1 Publication1
Alternative sequenceiVSP_028256845A → EHLESASSNSGIPAAQRATS VDYSSFADRCSSWIELIKLK AQTIRRGSIKTT in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_055640845A → EHLESASSNSGIPAAQRDRC SSWIELIKLKAQTIRRGSIK TT in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB011100 mRNA Translation: BAA25454.3 Different initiation.
AY166851 mRNA Translation: AAO17290.1
AK295862 mRNA Translation: BAG58665.1 Frameshift.
AK299353 mRNA Translation: BAG61349.1
AC053513 Genomic DNA No translation available.
BC042498 mRNA Translation: AAH42498.2
BC053885 mRNA Translation: AAH53885.1
BC117143 mRNA Translation: AAI17144.1
BC143878 mRNA Translation: AAI43879.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31758.1 [Q86YS7-1]
CCDS66337.1 [Q86YS7-3]
CCDS66338.1 [Q86YS7-2]
CCDS66339.1 [Q86YS7-5]
CCDS66340.1 [Q86YS7-4]

Protein sequence database of the Protein Information Resource

More...PIRi		T00072

NCBI Reference Sequences

More...RefSeqi		NP_001273102.1, NM_001286173.1 [Q86YS7-4]
NP_001273103.1, NM_001286174.1 [Q86YS7-3]
NP_001273104.1, NM_001286175.1 [Q86YS7-5]
NP_001273105.1, NM_001286176.1 [Q86YS7-3]
NP_001273106.1, NM_001286177.1 [Q86YS7-2]
NP_055617.1, NM_014802.2 [Q86YS7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000333957; ENSP00000334229; ENSG00000111731 [Q86YS7-1]
ENST00000396028; ENSP00000379345; ENSG00000111731 [Q86YS7-2]
ENST00000446597; ENSP00000388756; ENSG00000111731 [Q86YS7-3]
ENST00000536386; ENSP00000439392; ENSG00000111731 [Q86YS7-4]
ENST00000542676; ENSP00000441951; ENSG00000111731 [Q86YS7-3]
ENST00000545552; ENSP00000443204; ENSG00000111731 [Q86YS7-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9847

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9847

UCSC genome browser

More...UCSCi		uc001rfq.5, human [Q86YS7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011100 mRNA Translation: BAA25454.3 Different initiation.
AY166851 mRNA Translation: AAO17290.1
AK295862 mRNA Translation: BAG58665.1 Frameshift.
AK299353 mRNA Translation: BAG61349.1
AC053513 Genomic DNA No translation available.
BC042498 mRNA Translation: AAH42498.2
BC053885 mRNA Translation: AAH53885.1
BC117143 mRNA Translation: AAI17144.1
BC143878 mRNA Translation: AAI43879.1
CCDSiCCDS31758.1 [Q86YS7-1]
CCDS66337.1 [Q86YS7-3]
CCDS66338.1 [Q86YS7-2]
CCDS66339.1 [Q86YS7-5]
CCDS66340.1 [Q86YS7-4]
PIRiT00072
RefSeqiNP_001273102.1, NM_001286173.1 [Q86YS7-4]
NP_001273103.1, NM_001286174.1 [Q86YS7-3]
NP_001273104.1, NM_001286175.1 [Q86YS7-5]
NP_001273105.1, NM_001286176.1 [Q86YS7-3]
NP_001273106.1, NM_001286177.1 [Q86YS7-2]
NP_055617.1, NM_014802.2 [Q86YS7-1]

3D structure databases

SMRiQ86YS7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi115182, 44 interactors
IntActiQ86YS7, 32 interactors
STRINGi9606.ENSP00000443204

PTM databases

iPTMnetiQ86YS7
PhosphoSitePlusiQ86YS7

Polymorphism and mutation databases

BioMutaiC2CD5
DMDMi74750574

Proteomic databases

EPDiQ86YS7
jPOSTiQ86YS7
MassIVEiQ86YS7
MaxQBiQ86YS7
PaxDbiQ86YS7
PeptideAtlasiQ86YS7
PRIDEiQ86YS7
ProteomicsDBi25908
26956
4964
70464 [Q86YS7-1]
70465 [Q86YS7-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		24138, 45 antibodies

Genome annotation databases

EnsembliENST00000333957; ENSP00000334229; ENSG00000111731 [Q86YS7-1]
ENST00000396028; ENSP00000379345; ENSG00000111731 [Q86YS7-2]
ENST00000446597; ENSP00000388756; ENSG00000111731 [Q86YS7-3]
ENST00000536386; ENSP00000439392; ENSG00000111731 [Q86YS7-4]
ENST00000542676; ENSP00000441951; ENSG00000111731 [Q86YS7-3]
ENST00000545552; ENSP00000443204; ENSG00000111731 [Q86YS7-5]
GeneIDi9847
KEGGihsa:9847
UCSCiuc001rfq.5, human [Q86YS7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9847
DisGeNETi9847
EuPathDBiHostDB:ENSG00000111731.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		C2CD5
HGNCiHGNC:29062, C2CD5
HPAiENSG00000111731, Low tissue specificity
MIMi618044, gene
neXtProtiNX_Q86YS7
OpenTargetsiENSG00000111731
PharmGKBiPA143485515

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1031, Eukaryota
GeneTreeiENSGT00390000000212
HOGENOMiCLU_003204_0_0_1
InParanoidiQ86YS7
OMAiDANKMKY
OrthoDBi266134at2759
PhylomeDBiQ86YS7
TreeFamiTF323431

Enzyme and pathway databases

PathwayCommonsiQ86YS7
ReactomeiR-HSA-1445148, Translocation of SLC2A4 (GLUT4) to the plasma membrane

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9847, 4 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		C2CD5, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9847
PharosiQ86YS7, Tbio

Protein Ontology

More...PROi		PR:Q86YS7
RNActiQ86YS7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000111731, Expressed in secondary oocyte and 244 other tissues
ExpressionAtlasiQ86YS7, baseline and differential
GenevisibleiQ86YS7, HS

Family and domain databases

CDDicd08688, C2_KIAA0528-like, 1 hit
Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR037785, C2_C2CD5
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR038983, C2CD5
PANTHERiPTHR37412, PTHR37412, 1 hit
PfamiView protein in Pfam
PF00168, C2, 1 hit
SMARTiView protein in SMART
SM00239, C2, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC2CD5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86YS7
Secondary accession number(s): B4DJ03
, B4DRN7, B7ZLL0, F5H2A1, F5H5R1, O60280, Q17RY7, Q7Z619, Q86SU3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: June 1, 2003
Last modified: October 7, 2020
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again