Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (31 Jul 2019)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Peroxisome proliferator-activated receptor gamma coactivator 1-beta

Gene

PPARGC1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcriptional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • AF-2 domain binding Source: UniProtKB
  • RNA binding Source: UniProtKB
  • estrogen receptor binding Source: UniProtKB
  • nuclear receptor transcription coactivator activity Source: UniProtKB
  • transcription coregulator activity Source: UniProtKB
  • transcription factor binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, RNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1989781 PPARA activates gene expression
R-HSA-2151201 Transcriptional activation of mitochondrial biogenesis
R-HSA-8939902 Regulation of RUNX2 expression and activity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peroxisome proliferator-activated receptor gamma coactivator 1-beta
Short name:
PGC-1-beta
Short name:
PPAR-gamma coactivator 1-beta
Short name:
PPARGC-1-beta
Alternative name(s):
PGC-1-related estrogen receptor alpha coactivator
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPARGC1B
Synonyms:PERC, PGC1, PGC1B, PPARGC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30022 PPARGC1B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608886 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86YN6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi92 – 96LLAEL → AAAEA: Reduces DNA transcriptional activity. 1 Publication5
Mutagenesisi155 – 160LLQKLL → AAQKAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 343-AREAA-347. 1 Publication6
Mutagenesisi343 – 347LRELL → AREAA: Reduces interaction and activation of ESR1. Loss of interaction and activation of ESR1; when associated with 155-AAQKAA-160. 1 Publication5

Organism-specific databases

DisGeNET

More...
DisGeNETi
133522

MalaCards human disease database

More...
MalaCardsi
PPARGC1B

Open Targets

More...
OpenTargetsi
ENSG00000155846

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134953410

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PPARGC1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242724

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002401581 – 1023Peroxisome proliferator-activated receptor gamma coactivator 1-betaAdd BLAST1023

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei384PhosphoserineCombined sources1
Modified residuei524PhosphoserineCombined sources1
Modified residuei638PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86YN6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86YN6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86YN6

PeptideAtlas

More...
PeptideAtlasi
Q86YN6

PRoteomics IDEntifications database

More...
PRIDEi
Q86YN6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70440 [Q86YN6-1]
70441 [Q86YN6-2]
70442 [Q86YN6-3]
70443 [Q86YN6-4]
70444 [Q86YN6-5]
70445 [Q86YN6-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86YN6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86YN6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous with higher expression in heart, brain and skeletal muscle.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Repressed by saturated fatty acids such as palmitate and stearate in skeletal muscle cells. Induced by insulin and reduced by aging in skeletal muscle biopsies. Down-regulated in type 2 diabetes mellitus subjects as well as in pre-diabetics.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155846 Expressed in 166 organ(s), highest expression level in quadriceps femoris

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86YN6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86YN6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA050543

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with hepatocyte nuclear factor 4-alpha/HNF4A, Sterol regulatory binding transcription factor 1/SREBF1, PPAR-alpha/PPARA, thyroid hormone receptor beta/THRB and host cell factor/HCFC1.

Interacts with estrogen-related receptor gamma/ESRRG and alpha/ESRRA.

Interacts with PRDM16 (By similarity).

Interacts with estrogen receptor alpha/ESR1.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126361, 20 interactors

Protein interaction database and analysis system

More...
IntActi
Q86YN6, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000312649

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11023
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86YN6

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q86YN6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini902 – 976RRMPROSITE-ProRule annotationAdd BLAST75

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 91Abolishes DNA transcriptional activity when missingAdd BLAST91

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi156 – 160LXXLL motif 15
Motifi343 – 347LXXLL motif 25
Motifi691 – 694HCFC1-binding-motif (HBM)4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi430 – 450Glu-richAdd BLAST21
Compositional biasi772 – 823Glu-richAdd BLAST52

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IIJJ Eukaryota
ENOG4111PZ5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183137

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000236356

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86YN6

KEGG Orthology (KO)

More...
KOi
K17962

Identification of Orthologs from Complete Genome Data

More...
OMAi
RRTFRCE

Database of Orthologous Groups

More...
OrthoDBi
94418at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86YN6

TreeFam database of animal gene trees

More...
TreeFami
TF343068

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12356 RRM_PPARGC1B, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR034605 PGC-1
IPR034621 PGC-1beta
IPR034177 PPARGC1B_RRM
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

The PANTHER Classification System

More...
PANTHERi
PTHR15528 PTHR15528, 1 hit
PTHR15528:SF12 PTHR15528:SF12, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86YN6-1) [UniParc]FASTAAdd to basket
Also known as: PGC1beta-1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGNDCGALL DEELSSFFLN YLADTQGGGS GEEQLYADFP ELDLSQLDAS
60 70 80 90 100
DFDSATCFGE LQWCPENSET EPNQYSPDDS ELFQIDSENE ALLAELTKTL
110 120 130 140 150
DDIPEDDVGL AAFPALDGGD ALSCTSASPA PSSAPPSPAP EKPSAPAPEV
160 170 180 190 200
DELSLLQKLL LATSYPTSSS DTQKEGTAWR QAGLRSKSQR PCVKADSTQD
210 220 230 240 250
KKAPMMQSQS RSCTELHKHL TSAQCCLQDR GLQPPCLQSP RLPAKEDKEP
260 270 280 290 300
GEDCPSPQPA PASPRDSLAL GRADPGAPVS QEDMQAMVQL IRYMHTYCLP
310 320 330 340 350
QRKLPPQTPE PLPKACSNPS QQVRSRPWSR HHSKASWAEF SILRELLAQD
360 370 380 390 400
VLCDVSKPYR LATPVYASLT PRSRPRPPKD SQASPGRPSS VEEVRIAASP
410 420 430 440 450
KSTGPRPSLR PLRLEVKREV RRPARLQQQE EEDEEEEEEE EEEEKEEEEE
460 470 480 490 500
WGRKRPGRGL PWTKLGRKLE SSVCPVRRSR RLNPELGPWL TFADEPLVPS
510 520 530 540 550
EPQGALPSLC LAPKAYDVER ELGSPTDEDS GQDQQLLRGP QIPALESPCE
560 570 580 590 600
SGCGDMDEDP SCPQLPPRDS PRCLMLALSQ SDPTFGKKSF EQTLTVELCG
610 620 630 640 650
TAGLTPPTTP PYKPTEEDPF KPDIKHSLGK EIALSLPSPE GLSLKATPGA
660 670 680 690 700
AHKLPKKHPE RSELLSHLRH ATAQPASQAG QKRPFSCSFG DHDYCQVLRP
710 720 730 740 750
EGVLQRKVLR SWEPSGVHLE DWPQQGAPWA EAQAPGREED RSCDAGAPPK
760 770 780 790 800
DSTLLRDHEI RASLTKHFGL LETALEEEDL ASCKSPEYDT VFEDSSSSSG
810 820 830 840 850
ESSFLPEEEE EEGEEEEEDD EEEDSGVSPT CSDHCPYQSP PSKANRQLCS
860 870 880 890 900
RSRSSSGSSP CHSWSPATRR NFRCESRGPC SDRTPSIRHA RKRREKAIGE
910 920 930 940 950
GRVVYIQNLS SDMSSRELKR RFEVFGEIEE CEVLTRNRRG EKYGFITYRC
960 970 980 990 1000
SEHAALSLTK GAALRKRNEP SFQLSYGGLR HFCWPRYTDY DSNSEEALPA
1010 1020
SGKSKYEAMD FDSLLKEAQQ SLH
Length:1,023
Mass (Da):113,222
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC37FCDE4D3CD239
GO
Isoform 2 (identifier: Q86YN6-2) [UniParc]FASTAAdd to basket
Also known as: PGC1beta-2a

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK

Show »
Length:1,002
Mass (Da):110,981
Checksum:i8ACBD368E172B27E
GO
Isoform 3 (identifier: Q86YN6-3) [UniParc]FASTAAdd to basket
Also known as: PGC1beta-1b

The sequence of this isoform differs from the canonical sequence as follows:
     991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS

Show »
Length:1,017
Mass (Da):112,568
Checksum:iF2229A0A356A2148
GO
Isoform 4 (identifier: Q86YN6-4) [UniParc]FASTAAdd to basket
Also known as: PGC1beta-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MAGNDCGALLDEELSSFFLNYLADTQ → MGVYK
     991-1023: DSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH → GKPLKPSHSLVRLKAWEAVPSLNKTQS

Show »
Length:996
Mass (Da):110,327
Checksum:i5265F3916B919ECC
GO
Isoform 5 (identifier: Q86YN6-5) [UniParc]FASTAAdd to basket
Also known as: PERC-s

The sequence of this isoform differs from the canonical sequence as follows:
     156-194: Missing.

Note: Lacks LXXLL motif 1 and has a reduced ability to enhance the hormone-dependent activity of estrogen receptor alpha.
Show »
Length:984
Mass (Da):108,919
Checksum:i5D91928FD6D6D104
GO
Isoform 6 (identifier: Q86YN6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MAGNDCGALLDEELSSFFLNYLADTQ → M
     156-194: Missing.

Note: No experimental confirmation available.
Show »
Length:959
Mass (Da):106,230
Checksum:iD4E5EF57FC0C2459
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y713H0Y713_HUMAN
Peroxisome proliferator-activated r...
PPARGC1B
748Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti558E → G in BAC04541 (PubMed:14702039).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Variation of PPARGC1B may contribute to the pathogenesis of obesity, with a widespread Ala-203 allele being a risk factor for the development of this common disorders.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026698203A → P1 PublicationCorresponds to variant dbSNP:rs7732671EnsemblClinVar.1
Natural variantiVAR_026699265R → Q1 PublicationCorresponds to variant dbSNP:rs45520937Ensembl.1
Natural variantiVAR_026700279V → I1 PublicationCorresponds to variant dbSNP:rs17572019Ensembl.1
Natural variantiVAR_026701292R → S2 PublicationsCorresponds to variant dbSNP:rs11959820Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0192991 – 26MAGND…LADTQ → MGVYK in isoform 2 and isoform 4. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_0433741 – 26MAGND…LADTQ → M in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_019300156 – 194Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST39
Alternative sequenceiVSP_019301991 – 1023DSNSE…QQSLH → GKPLKPSHSLVRLKAWEAVP SLNKTQS in isoform 3 and isoform 4. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF468496 mRNA Translation: AAL78633.1
AF468497 mRNA Translation: AAL78634.1
AY188947 mRNA Translation: AAO40022.1
AY188948 mRNA Translation: AAO40023.1
AY188949 mRNA Translation: AAO40024.1
AY188950 mRNA Translation: AAO40025.1
AK095391 mRNA Translation: BAC04541.1
AK123614 mRNA Translation: BAG53922.1
AC008545 Genomic DNA No translation available.
AC022100 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61759.1
BC132971 mRNA Translation: AAI32972.1
BC132973 mRNA Translation: AAI32974.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4298.1 [Q86YN6-1]
CCDS54933.1 [Q86YN6-5]
CCDS54934.1 [Q86YN6-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001166169.1, NM_001172698.1 [Q86YN6-5]
NP_001166170.1, NM_001172699.1 [Q86YN6-6]
NP_573570.3, NM_133263.3 [Q86YN6-1]
XP_005268429.1, XM_005268372.4 [Q86YN6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309241; ENSP00000312649; ENSG00000155846 [Q86YN6-1]
ENST00000360453; ENSP00000353638; ENSG00000155846 [Q86YN6-5]
ENST00000394320; ENSP00000377855; ENSG00000155846 [Q86YN6-3]
ENST00000403750; ENSP00000384403; ENSG00000155846 [Q86YN6-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
133522

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:133522

UCSC genome browser

More...
UCSCi
uc003lrb.3 human [Q86YN6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF468496 mRNA Translation: AAL78633.1
AF468497 mRNA Translation: AAL78634.1
AY188947 mRNA Translation: AAO40022.1
AY188948 mRNA Translation: AAO40023.1
AY188949 mRNA Translation: AAO40024.1
AY188950 mRNA Translation: AAO40025.1
AK095391 mRNA Translation: BAC04541.1
AK123614 mRNA Translation: BAG53922.1
AC008545 Genomic DNA No translation available.
AC022100 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61759.1
BC132971 mRNA Translation: AAI32972.1
BC132973 mRNA Translation: AAI32974.1
CCDSiCCDS4298.1 [Q86YN6-1]
CCDS54933.1 [Q86YN6-5]
CCDS54934.1 [Q86YN6-6]
RefSeqiNP_001166169.1, NM_001172698.1 [Q86YN6-5]
NP_001166170.1, NM_001172699.1 [Q86YN6-6]
NP_573570.3, NM_133263.3 [Q86YN6-1]
XP_005268429.1, XM_005268372.4 [Q86YN6-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3SP6X-ray2.21B153-163[»]
6D0YX-ray2.68B994-1023[»]
SMRiQ86YN6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi126361, 20 interactors
IntActiQ86YN6, 3 interactors
STRINGi9606.ENSP00000312649

PTM databases

iPTMnetiQ86YN6
PhosphoSitePlusiQ86YN6

Polymorphism and mutation databases

BioMutaiPPARGC1B
DMDMi116242724

Proteomic databases

jPOSTiQ86YN6
MaxQBiQ86YN6
PaxDbiQ86YN6
PeptideAtlasiQ86YN6
PRIDEiQ86YN6
ProteomicsDBi70440 [Q86YN6-1]
70441 [Q86YN6-2]
70442 [Q86YN6-3]
70443 [Q86YN6-4]
70444 [Q86YN6-5]
70445 [Q86YN6-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309241; ENSP00000312649; ENSG00000155846 [Q86YN6-1]
ENST00000360453; ENSP00000353638; ENSG00000155846 [Q86YN6-5]
ENST00000394320; ENSP00000377855; ENSG00000155846 [Q86YN6-3]
ENST00000403750; ENSP00000384403; ENSG00000155846 [Q86YN6-6]
GeneIDi133522
KEGGihsa:133522
UCSCiuc003lrb.3 human [Q86YN6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
133522
DisGeNETi133522

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPARGC1B
HGNCiHGNC:30022 PPARGC1B
HPAiHPA050543
MalaCardsiPPARGC1B
MIMi608886 gene
neXtProtiNX_Q86YN6
OpenTargetsiENSG00000155846
PharmGKBiPA134953410

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IIJJ Eukaryota
ENOG4111PZ5 LUCA
GeneTreeiENSGT00950000183137
HOGENOMiHOG000236356
InParanoidiQ86YN6
KOiK17962
OMAiRRTFRCE
OrthoDBi94418at2759
PhylomeDBiQ86YN6
TreeFamiTF343068

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression
R-HSA-2151201 Transcriptional activation of mitochondrial biogenesis
R-HSA-8939902 Regulation of RUNX2 expression and activity

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PPARGC1B human
EvolutionaryTraceiQ86YN6

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PPARGC1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
133522

Protein Ontology

More...
PROi
PR:Q86YN6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000155846 Expressed in 166 organ(s), highest expression level in quadriceps femoris
ExpressionAtlasiQ86YN6 baseline and differential
GenevisibleiQ86YN6 HS

Family and domain databases

CDDicd12356 RRM_PPARGC1B, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR034605 PGC-1
IPR034621 PGC-1beta
IPR034177 PPARGC1B_RRM
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PANTHERiPTHR15528 PTHR15528, 1 hit
PTHR15528:SF12 PTHR15528:SF12, 1 hit
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRGC2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86YN6
Secondary accession number(s): A2RUM8
, A2RUN0, B3KVW0, Q86YN3, Q86YN4, Q86YN5, Q8N1N9, Q8TDE4, Q8TDE5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: October 17, 2006
Last modified: July 31, 2019
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again