Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (02 Jun 2021)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Testis development-related protein

Gene

TDRP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to normal sperm motility, but not essential for male fertility.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86YL5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Testis development-related protein
Alternative name(s):
Protein INM01
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TDRP
Synonyms:C8orf42
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26951, TDRP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
619049, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86YL5

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000180190.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
157695

Open Targets

More...
OpenTargetsi
ENSG00000180190

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672361

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86YL5, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TDRP

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003082191 – 185Testis development-related proteinAdd BLAST185

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86YL5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86YL5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86YL5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86YL5

PeptideAtlas

More...
PeptideAtlasi
Q86YL5

PRoteomics IDEntifications database

More...
PRIDEi
Q86YL5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
6251
70428 [Q86YL5-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86YL5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86YL5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in spermatogenic cells, especially in spermatocytes (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000180190, Expressed in secondary oocyte and 202 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86YL5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000180190, Tissue enhanced (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PRM2.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127614, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000430325

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86YL5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86YL5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 29DisorderedSequence analysisAdd BLAST29
Regioni121 – 156DisorderedSequence analysisAdd BLAST36

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TDRP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RYNW, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017888

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_094260_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86YL5

Identification of Orthologs from Complete Genome Data

More...
OMAi
CFWESVT

Database of Orthologous Groups

More...
OrthoDBi
1500031at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86YL5

TreeFam database of animal gene trees

More...
TreeFami
TF335521

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031399, TDRP

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15683, TDRP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q86YL5-1) [UniParc]FASTAAdd to basket
Also known as: TDRP1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWKLGRGRVL LDEPPEEEDG LRGGPPPAAA AAAQAQVQGA SFRGWKEVTS
60 70 80 90 100
LFNKDDEQHL LERCKSPKSK GTNLRLKEEL KAEKKSGFWD NLVLKQNIQS
110 120 130 140 150
KKPDEIEGWE PPKLALEDIS ADPEDTVGGH PSWSGWEDDA KGSTKYTSLA
160 170 180
SSANSSRWSL RAAGRLVSIR RQSKGHLTDS PEEAE
Length:185
Mass (Da):20,403
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBEE358C6A468DD42
GO
Isoform 2 (identifier: Q86YL5-2) [UniParc]FASTAAdd to basket
Also known as: TDRP2

The sequence of this isoform differs from the canonical sequence as follows:
     167-185: VSIRRQSKGHLTDSPEEAE → IKEVWINFSQLIISFRKHCLAHYRELRLCIKY

Show »
Length:198
Mass (Da):22,285
Checksum:iDA7BE826E28B8D1F
GO

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The poly-Ala region seems to be polymorphic and the number of Ala varies between 4 and 6.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045212167 – 185VSIRR…PEEAE → IKEVWINFSQLIISFRKHCL AHYRELRLCIKY in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY194292 mRNA Translation: AAO23974.2
FJ381685 mRNA Translation: ACJ10204.1
AC083964 Genomic DNA No translation available.
AC090135 Genomic DNA No translation available.
AC090691 Genomic DNA No translation available.
BC136248 mRNA Translation: AAI36249.1
BC136249 mRNA Translation: AAI36250.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47759.1 [Q86YL5-1]
CCDS59090.1 [Q86YL5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001243042.1, NM_001256113.1 [Q86YL5-2]
NP_778250.2, NM_175075.4 [Q86YL5-1]
XP_006716295.1, XM_006716232.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000324079; ENSP00000315111; ENSG00000180190 [Q86YL5-1]
ENST00000523656; ENSP00000430325; ENSG00000180190 [Q86YL5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
157695

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:157695

UCSC genome browser

More...
UCSCi
uc011kwg.3, human [Q86YL5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY194292 mRNA Translation: AAO23974.2
FJ381685 mRNA Translation: ACJ10204.1
AC083964 Genomic DNA No translation available.
AC090135 Genomic DNA No translation available.
AC090691 Genomic DNA No translation available.
BC136248 mRNA Translation: AAI36249.1
BC136249 mRNA Translation: AAI36250.1
CCDSiCCDS47759.1 [Q86YL5-1]
CCDS59090.1 [Q86YL5-2]
RefSeqiNP_001243042.1, NM_001256113.1 [Q86YL5-2]
NP_778250.2, NM_175075.4 [Q86YL5-1]
XP_006716295.1, XM_006716232.3

3D structure databases

SMRiQ86YL5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127614, 2 interactors
STRINGi9606.ENSP00000430325

PTM databases

iPTMnetiQ86YL5
PhosphoSitePlusiQ86YL5

Genetic variation databases

BioMutaiTDRP

Proteomic databases

EPDiQ86YL5
jPOSTiQ86YL5
MassIVEiQ86YL5
PaxDbiQ86YL5
PeptideAtlasiQ86YL5
PRIDEiQ86YL5
ProteomicsDBi6251
70428 [Q86YL5-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2036, 49 antibodies

The DNASU plasmid repository

More...
DNASUi
157695

Genome annotation databases

EnsembliENST00000324079; ENSP00000315111; ENSG00000180190 [Q86YL5-1]
ENST00000523656; ENSP00000430325; ENSG00000180190 [Q86YL5-2]
GeneIDi157695
KEGGihsa:157695
UCSCiuc011kwg.3, human [Q86YL5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
157695
DisGeNETi157695

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TDRP
HGNCiHGNC:26951, TDRP
HPAiENSG00000180190, Tissue enhanced (placenta)
MIMi619049, gene
neXtProtiNX_Q86YL5
OpenTargetsiENSG00000180190
PharmGKBiPA142672361
VEuPathDBiHostDB:ENSG00000180190.11

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RYNW, Eukaryota
GeneTreeiENSGT00390000017888
HOGENOMiCLU_094260_0_0_1
InParanoidiQ86YL5
OMAiCFWESVT
OrthoDBi1500031at2759
PhylomeDBiQ86YL5
TreeFamiTF335521

Enzyme and pathway databases

PathwayCommonsiQ86YL5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
157695, 5 hits in 956 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TDRP, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
157695
PharosiQ86YL5, Tbio

Protein Ontology

More...
PROi
PR:Q86YL5
RNActiQ86YL5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000180190, Expressed in secondary oocyte and 202 other tissues
GenevisibleiQ86YL5, HS

Family and domain databases

InterProiView protein in InterPro
IPR031399, TDRP
PfamiView protein in Pfam
PF15683, TDRP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTDRP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86YL5
Secondary accession number(s): B6VF03, B9EG53
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: June 2, 2021
This is version 104 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again