Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (02 Jun 2021)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein DZIP1

Gene

DZIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May participate in spermatogenesis via its interaction with DAZ1 (PubMed:15081113).

Has a role in primary cilium formation (PubMed:19852954).

2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri198 – 221C2H2-typePROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86YF9

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5632684, Hedgehog 'on' state

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein DZIP1
Alternative name(s):
DAZ-interacting protein 1/2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DZIP1
Synonyms:DZIP, DZIP2, KIAA0996
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20908, DZIP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608671, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86YF9

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000134874.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
22873

Open Targets

More...
OpenTargetsi
ENSG00000134874

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134960194

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86YF9, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DZIP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50400485

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000471061 – 867Zinc finger protein DZIP1Add BLAST867

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86YF9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86YF9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86YF9

PeptideAtlas

More...
PeptideAtlasi
Q86YF9

PRoteomics IDEntifications database

More...
PRIDEi
Q86YF9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
70410 [Q86YF9-1]
70411 [Q86YF9-2]
70412 [Q86YF9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86YF9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86YF9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in testis. Also expressed in fetal brain, adult oocytes and ovary. Expressed in undifferentiated ES cells. In testis, it is probably specifically expressed in germ cells. Expressed in mature germ cells and secondary spermatocytes, while it is weakly or not expressed in primary spermatocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134874, Expressed in testis and 220 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86YF9, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000134874, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 1 and isoform 2 interact with DAZ1 proteins. May participate in an RNA-binding complex that functions in both ES cells and germ cells.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116540, 14 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q86YF9

Database of interacting proteins

More...
DIPi
DIP-35710N

Protein interaction database and analysis system

More...
IntActi
Q86YF9, 16 interactors

Molecular INTeraction database

More...
MINTi
Q86YF9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000257312

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86YF9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86YF9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni643 – 768DisorderedSequence analysisAdd BLAST126
Regioni796 – 867DisorderedSequence analysisAdd BLAST72

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili230 – 340Sequence analysisAdd BLAST111
Coiled coili401 – 445Sequence analysisAdd BLAST45
Coiled coili568 – 588Sequence analysisAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi643 – 657Polar residuesSequence analysisAdd BLAST15
Compositional biasi721 – 737Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi798 – 819Basic and acidic residuesSequence analysisAdd BLAST22
Compositional biasi843 – 867Polar residuesSequence analysisAdd BLAST25

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri198 – 221C2H2-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRAI, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156862

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018051_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86YF9

Identification of Orthologs from Complete Genome Data

More...
OMAi
TIEYLMH

Database of Orthologous Groups

More...
OrthoDBi
1162102at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86YF9

TreeFam database of animal gene trees

More...
TreeFami
TF330044

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032714, DZIP1_N
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13815, Dzip-like_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355, ZnF_C2H2, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 1 hit
PS50157, ZINC_FINGER_C2H2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q86YF9-1) [UniParc]FASTAAdd to basket
Also known as: DZIPt2, DZIP testis 2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAEAADWFS SMPFQKHVYY PLASGPEGPD VAVAAAAAGA ASMACAPPSA
60 70 80 90 100
ASGPLPFFQF RPRLESVDWR RLSAIDVDKV AGAVDVLTLQ ENIMNITFCK
110 120 130 140 150
LEDEKCPHCQ SGVDPVLLKL IRLAQFTIEY LLHSQEFLTS QLHTLEERLR
160 170 180 190 200
LSHCDGEQSK KLLTKQAGEI KTLKEECKRR KKMISTQQLM IEAKANYYQC
210 220 230 240 250
HFCDKAFMNQ AFLQSHIQRR HTEENSHFEY QKNAQIEKLR SEIVVLKEEL
260 270 280 290 300
QLTRSELEAA HHASAVRFSK EYEMQKTKEE DFLKLFDRWK EEEKEKLVDE
310 320 330 340 350
MEKVKEMFMK EFKELTSKNS ALEYQLSEIQ KSNMQIKSNI GTLKDAHEFK
360 370 380 390 400
EDRSPYPQDF HNVMQLLDSQ ESKWTARVQA IHQEHKKEKG RLLSHIEKLR
410 420 430 440 450
TSMIDDLNAS NVFYKKRIEE LGQRLQEQNE LIITQRQQIK DFTCNPLNSI
460 470 480 490 500
SEPKGNPLAW QAFESQPAAP AVPMNAPALH TLETKSSLPM VHEQAFSSHI
510 520 530 540 550
LEPIEELSEE EKGRENEQKL NNNKMHLRKA LKSNSSLTKG LRTMVEQNLM
560 570 580 590 600
EKLETLGINA DIRGISSDQL HRVLKSVESE RHKQEREIPN FHQIREFLEH
610 620 630 640 650
QVSCKIEEKA LLSSDQCSVS QMDTLSTGEV PKMIQLPSKN RQLIRQKAVS
660 670 680 690 700
TDRTSVPKIK KNVMEDPFPR KSSTITTPPF SSEEEQEDDD LIRAYASPGP
710 720 730 740 750
LPVPPPQNKG SFGKNTVKSD ADGTEGSEIE DTDDSPKPAG VAVKTPTEKV
760 770 780 790 800
EKMFPHRKNV NKPVGGTNVP EMFIKKEELQ ELKCADVEDE DWDISSLEEE
810 820 830 840 850
ISLGKKSGKE QKEPPPAKNE PHFAHVLNAW GAFNPKGPKG EGLQENESST
860
LKSSLVTVTD WSDTSDV
Length:867
Mass (Da):98,664
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C5A7B9438D40623
GO
Isoform 2 (identifier: Q86YF9-2) [UniParc]FASTAAdd to basket
Also known as: DZIPt1, DZIP testis 1

The sequence of this isoform differs from the canonical sequence as follows:
     455-474: GNPLAWQAFESQPAAPAVPM → V

Show »
Length:848
Mass (Da):96,698
Checksum:i846EAAA465692C75
GO
Isoform 3 (identifier: Q86YF9-3) [UniParc]FASTAAdd to basket
Also known as: DZIPb, DZIP brain

The sequence of this isoform differs from the canonical sequence as follows:
     12-12: M → MVRGGRPGRPRRGCRAGENRGFPGPPAPQPARPPSPPPAALSLCPPQ
     229-231: EYQ → GHL
     232-867: Missing.

Show »
Length:277
Mass (Da):30,798
Checksum:i3647AE58F3E2915A
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL36978 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA76840 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB43211 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti615D → G in CAB43211 (PubMed:17974005).Curated1
Sequence conflicti818 – 819KN → EK in CAB43211 (PubMed:17974005).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052710172T → M. Corresponds to variant dbSNP:rs9561921Ensembl.1
Natural variantiVAR_052711664M → L. Corresponds to variant dbSNP:rs34303958EnsemblClinVar.1
Natural variantiVAR_019456736P → S1 PublicationCorresponds to variant dbSNP:rs11070136Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01096212M → MVRGGRPGRPRRGCRAGENR GFPGPPAPQPARPPSPPPAA LSLCPPQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_010963229 – 231EYQ → GHL in isoform 3. 1 Publication3
Alternative sequenceiVSP_010964232 – 867Missing in isoform 3. 1 PublicationAdd BLAST636
Alternative sequenceiVSP_010965455 – 474GNPLA…PAVPM → V in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF272347 mRNA Translation: AAL36978.1 Sequence problems.
AF272348 mRNA Translation: AAL36979.1
AB023213 mRNA Translation: BAA76840.2 Different initiation.
AL139376 Genomic DNA No translation available.
BC041804 mRNA Translation: AAH41804.1
AL049931 mRNA Translation: CAB43211.2 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9477.1 [Q86YF9-2]
CCDS9478.1 [Q86YF9-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T08668

NCBI Reference Sequences

More...
RefSeqi
NP_055749.1, NM_014934.4 [Q86YF9-2]
NP_945319.1, NM_198968.3 [Q86YF9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000347108; ENSP00000257312; ENSG00000134874 [Q86YF9-1]
ENST00000361156; ENSP00000355018; ENSG00000134874 [Q86YF9-2]
ENST00000361396; ENSP00000355175; ENSG00000134874 [Q86YF9-2]
ENST00000376829; ENSP00000366025; ENSG00000134874 [Q86YF9-1]
ENST00000466569; ENSP00000431168; ENSG00000134874 [Q86YF9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22873

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22873

UCSC genome browser

More...
UCSCi
uc001vmk.5, human [Q86YF9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF272347 mRNA Translation: AAL36978.1 Sequence problems.
AF272348 mRNA Translation: AAL36979.1
AB023213 mRNA Translation: BAA76840.2 Different initiation.
AL139376 Genomic DNA No translation available.
BC041804 mRNA Translation: AAH41804.1
AL049931 mRNA Translation: CAB43211.2 Different initiation.
CCDSiCCDS9477.1 [Q86YF9-2]
CCDS9478.1 [Q86YF9-1]
PIRiT08668
RefSeqiNP_055749.1, NM_014934.4 [Q86YF9-2]
NP_945319.1, NM_198968.3 [Q86YF9-1]

3D structure databases

SMRiQ86YF9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116540, 14 interactors
CORUMiQ86YF9
DIPiDIP-35710N
IntActiQ86YF9, 16 interactors
MINTiQ86YF9
STRINGi9606.ENSP00000257312

PTM databases

iPTMnetiQ86YF9
PhosphoSitePlusiQ86YF9

Genetic variation databases

BioMutaiDZIP1
DMDMi50400485

Proteomic databases

EPDiQ86YF9
MassIVEiQ86YF9
PaxDbiQ86YF9
PeptideAtlasiQ86YF9
PRIDEiQ86YF9
ProteomicsDBi70410 [Q86YF9-1]
70411 [Q86YF9-2]
70412 [Q86YF9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24832, 126 antibodies

The DNASU plasmid repository

More...
DNASUi
22873

Genome annotation databases

EnsembliENST00000347108; ENSP00000257312; ENSG00000134874 [Q86YF9-1]
ENST00000361156; ENSP00000355018; ENSG00000134874 [Q86YF9-2]
ENST00000361396; ENSP00000355175; ENSG00000134874 [Q86YF9-2]
ENST00000376829; ENSP00000366025; ENSG00000134874 [Q86YF9-1]
ENST00000466569; ENSP00000431168; ENSG00000134874 [Q86YF9-3]
GeneIDi22873
KEGGihsa:22873
UCSCiuc001vmk.5, human [Q86YF9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22873
DisGeNETi22873

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DZIP1
HGNCiHGNC:20908, DZIP1
HPAiENSG00000134874, Low tissue specificity
MIMi608671, gene
neXtProtiNX_Q86YF9
OpenTargetsiENSG00000134874
PharmGKBiPA134960194
VEuPathDBiHostDB:ENSG00000134874.17

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QRAI, Eukaryota
GeneTreeiENSGT00940000156862
HOGENOMiCLU_018051_1_0_1
InParanoidiQ86YF9
OMAiTIEYLMH
OrthoDBi1162102at2759
PhylomeDBiQ86YF9
TreeFamiTF330044

Enzyme and pathway databases

PathwayCommonsiQ86YF9
ReactomeiR-HSA-5632684, Hedgehog 'on' state

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
22873, 3 hits in 992 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DZIP1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DZIP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22873
PharosiQ86YF9, Tbio

Protein Ontology

More...
PROi
PR:Q86YF9
RNActiQ86YF9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000134874, Expressed in testis and 220 other tissues
GenevisibleiQ86YF9, HS

Family and domain databases

InterProiView protein in InterPro
IPR032714, DZIP1_N
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF13815, Dzip-like_N, 1 hit
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 1 hit
PROSITEiView protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 1 hit
PS50157, ZINC_FINGER_C2H2_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDZIP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86YF9
Secondary accession number(s): Q5W078
, Q5W079, Q8WY45, Q8WY46, Q9UGA5, Q9Y2K0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: June 1, 2003
Last modified: June 2, 2021
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again