Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (11 Dec 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein Niban 3

Gene

NIBAN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein Niban 3Curated
Alternative name(s):
B-cell novel protein 11 Publication
Niban-like protein 2Curated
Protein FAM129C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NIBAN3Imported
Synonyms:BCNP11 Publication, FAM129C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000167483.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24130 NIBAN3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609967 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86XR2

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
199786

Open Targets

More...
OpenTargetsi
ENSG00000167483

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162386017

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86XR2 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM129C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373397

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003237591 – 697Protein Niban 3Add BLAST697

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86XR2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86XR2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86XR2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86XR2

PeptideAtlas

More...
PeptideAtlasi
Q86XR2

PRoteomics IDEntifications database

More...
PRIDEi
Q86XR2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
4725
70316 [Q86XR2-1]
70317 [Q86XR2-2]
70318 [Q86XR2-3]
70319 [Q86XR2-4]
70320 [Q86XR2-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86XR2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86XR2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in B-lymphocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167483 Expressed in 124 organ(s), highest expression level in spleen

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86XR2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86XR2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043277

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q86XR2, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000335040

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86XR2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86XR2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Niban family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJI8 Eukaryota
ENOG41102BB LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154149

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000169112

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86XR2

Identification of Orthologs from Complete Genome Data

More...
OMAi
EYLCLLD

Database of Orthologous Groups

More...
OrthoDBi
325978at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86XR2

TreeFam database of animal gene trees

More...
TreeFami
TF333351

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026088 Niban-like
IPR011993 PH-like_dom_sf
IPR001849 PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR14392 PTHR14392, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86XR2-1) [UniParc]FASTAAdd to basket
Also known as: 3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGPDRKEVPL SRGTQAVVVG KGRGAPGDDS SMGGRPSSPL DKQQRQHLRG
60 70 80 90 100
QVDTLLRNFL PCYRGQLAAS VLRQISRELG PQEPTGSQLL RSKKLPRVRE
110 120 130 140 150
HRGPLTQLRG HPPRWQPIFC VLRGDGRLEW FSHKEEYENG GHCLGSTALT
160 170 180 190 200
GYTLLTSQRE YLRLLDALCP ESLGDHTQEE PDSLLEVPVS FPLFLQHPFR
210 220 230 240 250
RHLCFSAATR EAQHAWRLAL QGGIRLQGIV LQRSQAPAAR AFLDAVRLYR
260 270 280 290 300
QHQGHFGDDD VTLGSDAEVL TAVLMREQLP ALRAQTLPGL RGAGRARAWA
310 320 330 340 350
WTELLDAVHA AVLAGASAGL CAFQPEKDEL LASLEKTIRP DVDQLLRQRA
360 370 380 390 400
RVAGRLRTDI RGPLESCLRR EVDPQLPRVV QTLLRTVEAS LEAVRTLLAQ
410 420 430 440 450
GMDRLSHRLR QSPSGTRLRR EVYSFGEMPW DLALMQTCYR EAERSRGRLG
460 470 480 490 500
QLAAPFGFLG MQSLVFGAQD LAQQLMADAV ATFLQLADQC LTTALNCDQA
510 520 530 540 550
AQRLERVRGR VLKKFKSDSG LAQRRFIRGW GLCIFLPFVL SQLEPGCKKE
560 570 580 590 600
LPEFEGDVLA VGSQALTTEG IYEDVIRGCL LQRIDQELKK TLGANDVSCT
610 620 630 640 650
LDGCLEVPWE QEGAAPNLNL VSSFLAGRQA FTDFLCLPAK SSANWILAAS
660 670 680 690
LLSCSCFRSG FHRDSRVFLV QLAEGLSHSL ETVSSHSVWS FRPTPRQ
Length:697
Mass (Da):77,413
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCCBE313060488839
GO
Isoform 2 (identifier: Q86XR2-2) [UniParc]FASTAAdd to basket
Also known as: 1

The sequence of this isoform differs from the canonical sequence as follows:
     615-697: APNLNLVSSF...VWSFRPTPRQ → GGELHRLLKH...LLTQPAWPSS

Show »
Length:666
Mass (Da):73,791
Checksum:iCE5C749E31E26E09
GO
Isoform 3 (identifier: Q86XR2-3) [UniParc]FASTAAdd to basket
Also known as: 2

The sequence of this isoform differs from the canonical sequence as follows:
     615-651: APNLNLVSSFLAGRQAFTDFLCLPAKSSANWILAASL → DEETEAEREGGACPRQPDSGAQIQPLCPPPSPGTFRS
     652-697: Missing.

Show »
Length:651
Mass (Da):72,197
Checksum:i31E1892A8B50E1A5
GO
Isoform 4 (identifier: Q86XR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     513-548: Missing.
     615-651: APNLNLVSSFLAGRQAFTDFLCLPAKSSANWILAASL → DEETEAEREGGACPRQPDSGAQIQPLCPPPSPGTFRS
     652-697: Missing.

Show »
Length:615
Mass (Da):68,089
Checksum:i9190363FEDC879E2
GO
Isoform 5 (identifier: Q86XR2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     550-593: ELPEFEGDVL...IDQELKKTLG → TESRSVAQAV...PSSWDYRHPL
     594-697: Missing.

Show »
Length:593
Mass (Da):66,253
Checksum:iD24EEC1AB442DE01
GO
Isoform 6 (identifier: Q86XR2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-274: Missing.

Show »
Length:423
Mass (Da):46,863
Checksum:i1708BC7C57AE215C
GO
Isoform 7 (identifier: Q86XR2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-94: Missing.
     587-614: Missing.
     615-651: APNLNLVSSFLAGRQAFTDFLCLPAKSSANWILAASL → DEETEAEREGGACPRQPDSGAQIQPLCPPPSPGTFRS
     652-697: Missing.

Show »
Length:600
Mass (Da):66,605
Checksum:i16D3C09F170A2D94
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QZV9M0QZV9_HUMAN
Protein Niban 3
NIBAN3
584Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXK3M0QXK3_HUMAN
Protein Niban 3
NIBAN3
620Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0A8M0R0A8_HUMAN
Protein Niban 3
NIBAN3
569Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0E0M0R0E0_HUMAN
Protein Niban 3
NIBAN3
666Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QX95M0QX95_HUMAN
Protein Niban 3
NIBAN3
562Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG62749 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 7 (identifier: Q86XR2-7)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti591P → S in BAG62749 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_039583229I → T4 PublicationsCorresponds to variant dbSNP:rs8107859Ensembl.1
Natural variantiVAR_062126493T → M. Corresponds to variant dbSNP:rs45532635Ensembl.1
Natural variantiVAR_039584543L → F. Corresponds to variant dbSNP:rs10401716Ensembl.1
Natural variantiVAR_039585603G → S. Corresponds to variant dbSNP:rs11666267Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0541241 – 274Missing in isoform 6. 1 PublicationAdd BLAST274
Alternative sequenceiVSP_05412572 – 94Missing in isoform 7. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_032126513 – 548Missing in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032127550 – 593ELPEF…KKTLG → TESRSVAQAVVQWCDLGSLR PPPPRFKRSSHLGLPSSWDY RHPL in isoform 5. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_054126587 – 614Missing in isoform 7. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_032128594 – 697Missing in isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_032129615 – 697APNLN…PTPRQ → GGELHRLLKHASDCWGWGGG GPHGVYGIVMSVGSWTEQNA LCLLTQPAWPSS in isoform 2. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_032130615 – 651APNLN…LAASL → DEETEAEREGGACPRQPDSG AQIQPLCPPPSPGTFRS in isoform 3, isoform 4 and isoform 7. 3 PublicationsAdd BLAST37
Alternative sequenceiVSP_032131652 – 697Missing in isoform 3, isoform 4 and isoform 7. 3 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY254197 mRNA Translation: AAO83574.1
AY254198 mRNA Translation: AAO83575.1
AY254199 mRNA Translation: AAO83576.1
AK298062 mRNA Translation: BAG60355.1
AK301159 mRNA Translation: BAG62749.1 Different initiation.
AC010618 Genomic DNA No translation available.
AK074069 mRNA Translation: BAB84895.1
BC053606 mRNA Translation: AAH53606.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12362.1 [Q86XR2-1]
CCDS42521.1 [Q86XR2-3]
CCDS82317.1 [Q86XR2-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001091994.1, NM_001098524.1
NP_001308756.1, NM_001321827.1
NP_001308757.1, NM_001321828.1 [Q86XR2-6]
NP_775815.2, NM_173544.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000332386; ENSP00000333447; ENSG00000167483 [Q86XR2-3]
ENST00000335393; ENSP00000335040; ENSG00000167483 [Q86XR2-1]
ENST00000449408; ENSP00000394929; ENSG00000167483 [Q86XR2-6]
ENST00000595684; ENSP00000470106; ENSG00000167483 [Q86XR2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
199786

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:199786

UCSC genome browser

More...
UCSCi
uc060vkb.1 human [Q86XR2-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY254197 mRNA Translation: AAO83574.1
AY254198 mRNA Translation: AAO83575.1
AY254199 mRNA Translation: AAO83576.1
AK298062 mRNA Translation: BAG60355.1
AK301159 mRNA Translation: BAG62749.1 Different initiation.
AC010618 Genomic DNA No translation available.
AK074069 mRNA Translation: BAB84895.1
BC053606 mRNA Translation: AAH53606.1
CCDSiCCDS12362.1 [Q86XR2-1]
CCDS42521.1 [Q86XR2-3]
CCDS82317.1 [Q86XR2-6]
RefSeqiNP_001091994.1, NM_001098524.1
NP_001308756.1, NM_001321827.1
NP_001308757.1, NM_001321828.1 [Q86XR2-6]
NP_775815.2, NM_173544.4

3D structure databases

SMRiQ86XR2
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ86XR2, 7 interactors
STRINGi9606.ENSP00000335040

PTM databases

iPTMnetiQ86XR2
PhosphoSitePlusiQ86XR2

Polymorphism and mutation databases

BioMutaiFAM129C
DMDMi317373397

Proteomic databases

jPOSTiQ86XR2
MassIVEiQ86XR2
MaxQBiQ86XR2
PaxDbiQ86XR2
PeptideAtlasiQ86XR2
PRIDEiQ86XR2
ProteomicsDBi4725
70316 [Q86XR2-1]
70317 [Q86XR2-2]
70318 [Q86XR2-3]
70319 [Q86XR2-4]
70320 [Q86XR2-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
199786

Genome annotation databases

EnsembliENST00000332386; ENSP00000333447; ENSG00000167483 [Q86XR2-3]
ENST00000335393; ENSP00000335040; ENSG00000167483 [Q86XR2-1]
ENST00000449408; ENSP00000394929; ENSG00000167483 [Q86XR2-6]
ENST00000595684; ENSP00000470106; ENSG00000167483 [Q86XR2-2]
GeneIDi199786
KEGGihsa:199786
UCSCiuc060vkb.1 human [Q86XR2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
199786
DisGeNETi199786
EuPathDBiHostDB:ENSG00000167483.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NIBAN3
HGNCiHGNC:24130 NIBAN3
HPAiHPA043277
MIMi609967 gene
neXtProtiNX_Q86XR2
OpenTargetsiENSG00000167483
PharmGKBiPA162386017

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJI8 Eukaryota
ENOG41102BB LUCA
GeneTreeiENSGT00940000154149
HOGENOMiHOG000169112
InParanoidiQ86XR2
OMAiEYLCLLD
OrthoDBi325978at2759
PhylomeDBiQ86XR2
TreeFamiTF333351

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
199786
PharosiQ86XR2 Tdark

Protein Ontology

More...
PROi
PR:Q86XR2
RNActiQ86XR2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167483 Expressed in 124 organ(s), highest expression level in spleen
ExpressionAtlasiQ86XR2 baseline and differential
GenevisibleiQ86XR2 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR026088 Niban-like
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR14392 PTHR14392, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNIBA3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86XR2
Secondary accession number(s): B4DNU3
, B4DVN7, Q7Z6H6, Q86XR3, Q86XR4, Q8TEQ3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: January 11, 2011
Last modified: December 11, 2019
This is version 116 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again