Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (31 Jul 2019)
Sequence version 3 (17 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein FAM131B

Gene

FAM131B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6802952 Signaling by BRAF and RAF fusions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM131B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM131B
Synonyms:KIAA0773
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:22202 FAM131B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86XD5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9715

NIAGADS Genomics Database

More...
NIAGADSi
ENSG00000159784

Open Targets

More...
OpenTargetsi
ENSG00000159784

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162386065

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM131B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002530321 – 332Protein FAM131BAdd BLAST332
Isoform 2 (identifier: Q86XD5-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei47PhosphoserineBy similarity1
Modified residuei114PhosphoserineBy similarity1
Modified residuei117PhosphoserineCombined sources1
Modified residuei295PhosphoserineBy similarity1
Modified residuei297PhosphoserineBy similarity1
Modified residuei313PhosphoserineBy similarity1
Modified residuei316PhosphothreonineBy similarity1
Modified residuei317PhosphoserineBy similarity1
Modified residuei318PhosphoserineBy similarity1
Modified residuei322PhosphoserineBy similarity1
Isoform 2 (identifier: Q86XD5-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86XD5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86XD5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86XD5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86XD5

PeptideAtlas

More...
PeptideAtlasi
Q86XD5

PRoteomics IDEntifications database

More...
PRIDEi
Q86XD5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70264 [Q86XD5-1]
70265 [Q86XD5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86XD5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86XD5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q86XD5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000159784 Expressed in 136 organ(s), highest expression level in C1 segment of cervical spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86XD5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86XD5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA021371
HPA029992

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-11308812,EBI-717399

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115064, 34 interactors

Protein interaction database and analysis system

More...
IntActi
Q86XD5, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000410603

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi283 – 286Poly-Glu4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM131 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IECV Eukaryota
ENOG4111H79 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183106

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86XD5

Identification of Orthologs from Complete Genome Data

More...
OMAi
DSWPHSY

Database of Orthologous Groups

More...
OrthoDBi
864510at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86XD5

TreeFam database of animal gene trees

More...
TreeFami
TF331537

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026782 FAM131

The PANTHER Classification System

More...
PANTHERi
PTHR15736 PTHR15736, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15010 FAM131, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86XD5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSTSSLHGS SLHRPSTEQT RTDFSWDGIN LSMEDTTSIL PKLKRNSNAY
60 70 80 90 100
GIGALAKSSF SGISRSMKDH VTKPTAMGQG RVAHMIEWQG WGKTPAVQPQ
110 120 130 140 150
HSHESVRRDT DAYSDLSDGE KEARFLAGVM EQFAISEATL MAWSSMDGED
160 170 180 190 200
MSVNSTQEPL GCNYSDNYQE LMDSQDALAQ APMDGWPHSY VSQGMYCLGS
210 220 230 240 250
SDAWEASDQS LIASPATGSY LGPAFDDSQP SLHEMGPSQP ASGYSALEPP
260 270 280 290 300
PLLGGDTDWA PGVGAVDLAR GPAEEEKRPL APEEEEDAGC RDLESLSPRE
310 320 330
DPEMSTALSR KVSDVTSSGV QSFDEEEGEA NN
Length:332
Mass (Da):35,769
Last modified:October 17, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i35FE42189855034F
GO
Isoform 2 (identifier: Q86XD5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN → MGCIGSRTVG...GSSLHRPSTE

Show »
Length:348
Mass (Da):37,348
Checksum:i99FDC411A64F5D05
GO
Isoform 3 (identifier: Q86XD5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGCIGSRTVGNEVIAVDWKGLKDVDQINM

Note: No experimental confirmation available.
Show »
Length:360
Mass (Da):38,769
Checksum:i31D3278DE4006168
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RJ60E5RJ60_HUMAN
Protein FAM131B
FAM131B
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RI17E5RI17_HUMAN
Protein FAM131B
FAM131B
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y3V6H0Y3V6_HUMAN
Protein FAM131B
FAM131B
11Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAS07501 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti47S → F in CAD89938 (PubMed:17974005).Curated1
Sequence conflicti141M → T in CAD89938 (PubMed:17974005).Curated1
Sequence conflicti285E → G in AAH45611 (PubMed:15489334).Curated1
Sequence conflicti291R → Q in AAH45611 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053920307A → T1 PublicationCorresponds to variant dbSNP:rs17854363Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0416331 – 30MDSTS…WDGIN → MGCIGSRTVGNEVIAVDWKG LKDVDQINMDSTSSLHGSSL HRPSTE in isoform 2. CuratedAdd BLAST30
Alternative sequenceiVSP_0467981M → MGCIGSRTVGNEVIAVDWKG LKDVDQINM in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK291470 mRNA Translation: BAF84159.1
AL832579 mRNA Translation: CAD89938.1
AC093673 Genomic DNA Translation: AAS07501.1 Sequence problems.
CH236959 Genomic DNA Translation: EAL23787.1
CH471198 Genomic DNA Translation: EAW51853.1
CH471198 Genomic DNA Translation: EAW51854.1
BC045611 mRNA Translation: AAH45611.2
BC050543 mRNA Translation: AAH50543.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47734.1 [Q86XD5-3]
CCDS5882.1 [Q86XD5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001026860.2, NM_001031690.2 [Q86XD5-3]
NP_001265226.1, NM_001278297.1
NP_055505.3, NM_014690.4 [Q86XD5-1]
XP_005250130.1, XM_005250073.3 [Q86XD5-1]
XP_006716249.1, XM_006716186.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000409222; ENSP00000387147; ENSG00000159784 [Q86XD5-1]
ENST00000409346; ENSP00000386984; ENSG00000159784 [Q86XD5-1]
ENST00000409408; ENSP00000387017; ENSG00000159784 [Q86XD5-1]
ENST00000409578; ENSP00000386568; ENSG00000159784 [Q86XD5-2]
ENST00000443739; ENSP00000410603; ENSG00000159784 [Q86XD5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9715

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9715

UCSC genome browser

More...
UCSCi
uc003wct.4 human [Q86XD5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291470 mRNA Translation: BAF84159.1
AL832579 mRNA Translation: CAD89938.1
AC093673 Genomic DNA Translation: AAS07501.1 Sequence problems.
CH236959 Genomic DNA Translation: EAL23787.1
CH471198 Genomic DNA Translation: EAW51853.1
CH471198 Genomic DNA Translation: EAW51854.1
BC045611 mRNA Translation: AAH45611.2
BC050543 mRNA Translation: AAH50543.2
CCDSiCCDS47734.1 [Q86XD5-3]
CCDS5882.1 [Q86XD5-1]
RefSeqiNP_001026860.2, NM_001031690.2 [Q86XD5-3]
NP_001265226.1, NM_001278297.1
NP_055505.3, NM_014690.4 [Q86XD5-1]
XP_005250130.1, XM_005250073.3 [Q86XD5-1]
XP_006716249.1, XM_006716186.2

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi115064, 34 interactors
IntActiQ86XD5, 3 interactors
STRINGi9606.ENSP00000410603

PTM databases

iPTMnetiQ86XD5
PhosphoSitePlusiQ86XD5
SwissPalmiQ86XD5

Polymorphism and mutation databases

BioMutaiFAM131B

Proteomic databases

EPDiQ86XD5
jPOSTiQ86XD5
MaxQBiQ86XD5
PaxDbiQ86XD5
PeptideAtlasiQ86XD5
PRIDEiQ86XD5
ProteomicsDBi70264 [Q86XD5-1]
70265 [Q86XD5-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9715
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409222; ENSP00000387147; ENSG00000159784 [Q86XD5-1]
ENST00000409346; ENSP00000386984; ENSG00000159784 [Q86XD5-1]
ENST00000409408; ENSP00000387017; ENSG00000159784 [Q86XD5-1]
ENST00000409578; ENSP00000386568; ENSG00000159784 [Q86XD5-2]
ENST00000443739; ENSP00000410603; ENSG00000159784 [Q86XD5-3]
GeneIDi9715
KEGGihsa:9715
UCSCiuc003wct.4 human [Q86XD5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9715
DisGeNETi9715

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM131B
HGNCiHGNC:22202 FAM131B
HPAiHPA021371
HPA029992
neXtProtiNX_Q86XD5
NIAGADSiENSG00000159784
OpenTargetsiENSG00000159784
PharmGKBiPA162386065

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IECV Eukaryota
ENOG4111H79 LUCA
GeneTreeiENSGT00950000183106
InParanoidiQ86XD5
OMAiDSWPHSY
OrthoDBi864510at2759
PhylomeDBiQ86XD5
TreeFamiTF331537

Enzyme and pathway databases

ReactomeiR-HSA-6802952 Signaling by BRAF and RAF fusions

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM131B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9715

Protein Ontology

More...
PROi
PR:Q86XD5

Gene expression databases

BgeeiENSG00000159784 Expressed in 136 organ(s), highest expression level in C1 segment of cervical spinal cord
ExpressionAtlasiQ86XD5 baseline and differential
GenevisibleiQ86XD5 HS

Family and domain databases

InterProiView protein in InterPro
IPR026782 FAM131
PANTHERiPTHR15736 PTHR15736, 1 hit
PfamiView protein in Pfam
PF15010 FAM131, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF131B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86XD5
Secondary accession number(s): A4D2H6
, A6NDW3, A8K605, B8ZZN2, D3DXE3, J3KQX2, Q7L0D6, Q86T97
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: July 31, 2019
This is version 115 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again