Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (12 Aug 2020)
Sequence version 2 (31 Aug 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Deaminated glutathione amidase

Gene

NIT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolysis of the amide bond in N-(4-oxoglutarate)-L-cysteinylglycine (deaminated glutathione), a metabolite repair reaction to dispose of the harmful deaminated glutathione. Plays a role in cell growth and apoptosis: loss of expression promotes cell growth, resistance to DNA damage stress and increased incidence to NMBA-induced tumors. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells.By similarity

Miscellaneous

According to Rosetta Stone theory, the existence of a fusion protein in one genome predicts that the separate polypeptides expressed in other organisms function in the same cellular or biochemical pathway. In Drosophila melanogaster and Caenorhabditis elegans, NitFhit is a fusion protein composed of a C-terminal Fhit domain and a domain related to plant and bacterial nitrilase.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei86Proton acceptorPROSITE-ProRule annotation1
Active sitei161Proton donorPROSITE-ProRule annotation1
Active sitei203NucleophilePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86X76

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Deaminated glutathione amidase (EC:3.5.1.128By similarity)
Short name:
dGSH amidase
Alternative name(s):
Nitrilase homolog 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NIT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000158793.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7828, NIT1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604618, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86X76

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4817

Open Targets

More...
OpenTargetsi
ENSG00000158793

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31636

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86X76, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4295883

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NIT1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51704324

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 13MitochondrionSequence analysisAdd BLAST13
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000021325114 – 327Deaminated glutathione amidaseSequence analysisAdd BLAST314

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86X76

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86X76

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86X76

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86X76

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86X76

PeptideAtlas

More...
PeptideAtlasi
Q86X76

PRoteomics IDEntifications database

More...
PRIDEi
Q86X76

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
70250 [Q86X76-1]
70251 [Q86X76-2]
70252 [Q86X76-3]
70253 [Q86X76-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86X76

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86X76

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158793, Expressed in left adrenal gland and 243 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86X76, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000158793, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
110882, 61 interactors

Protein interaction database and analysis system

More...
IntActi
Q86X76, 53 interactors

Molecular INTeraction database

More...
MINTi
Q86X76

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000356988

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86X76, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86X76

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini46 – 298CN hydrolasePROSITE-ProRule annotationAdd BLAST253

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0807, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00550000075099

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_030130_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86X76

KEGG Orthology (KO)

More...
KOi
K11206

Identification of Orthologs from Complete Genome Data

More...
OMAi
MTCYDVR

Database of Orthologous Groups

More...
OrthoDBi
1154369at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86X76

TreeFam database of animal gene trees

More...
TreeFami
TF313080

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.60.110.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003010, C-N_Hydrolase
IPR036526, C-N_Hydrolase_sf
IPR001110, UPF0012_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00795, CN_hydrolase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56317, SSF56317, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50263, CN_HYDROLASE, 1 hit
PS01227, UPF0012, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 2 (identifier: Q86X76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGFITRPPH RFLSLLCPGL RIPQLSVLCA QPRPRAMAIS SSSCELPLVA
60 70 80 90 100
VCQVTSTPDK QQNFKTCAEL VREAARLGAC LAFLPEAFDF IARDPAETLH
110 120 130 140 150
LSEPLGGKLL EEYTQLAREC GLWLSLGGFH ERGQDWEQTQ KIYNCHVLLN
160 170 180 190 200
SKGAVVATYR KTHLCDVEIP GQGPMCESNS TMPGPSLESP VSTPAGKIGL
210 220 230 240 250
AVCYDMRFPE LSLALAQAGA EILTYPSAFG SITGPAHWEV LLRARAIETQ
260 270 280 290 300
CYVVAAAQCG RHHEKRASYG HSMVVDPWGT VVARCSEGPG LCLARIDLNY
310 320
LRQLRRHLPV FQHRRPDLYG NLGHPLS
Note: Major isoform.
Length:327
Mass (Da):35,896
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i90F7FB9D4BA627B1
GO
Isoform 1 (identifier: Q86X76-2) [UniParc]FASTAAdd to basket
Also known as: 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Show »
Length:291
Mass (Da):31,859
Checksum:i314677E205F7ADDE
GO
Isoform 4 (identifier: Q86X76-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQ → MVLAISSCWA...PGRTYSLSRR
     327-327: S → SDLTSVSLDLPLPPPPCHYELVLM

Show »
Length:367
Mass (Da):40,200
Checksum:i178F0C4BBFE65D25
GO
Isoform 5 (identifier: Q86X76-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPR → MTFGLRKRLSEERGFSLM

Show »
Length:312
Mass (Da):34,323
Checksum:iA0BFFE4B76D24EE0
GO
Isoform 6 (identifier: Q86X76-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-243: VLLR → PVSS
     244-327: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a NIT1-DEDD fusion protein. The last 4 amino acids of this isoform (PVSS) are encoded by the last DEDD exon.Curated
Show »
Length:243
Mass (Da):26,326
Checksum:i283B9E8D6A4EF67D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti79A → P in AAH46149 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0115461 – 36Missing in isoform 1. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0115451 – 33MLGFI…CAQPR → MTFGLRKRLSEERGFSLM in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0115441 – 31MLGFI…VLCAQ → MVLAISSCWASSPGLLTDSC PFCVLDSGYLNSQYFVLSPG RTYSLSRR in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_053711240 – 243VLLR → PVSS in isoform 6. 1 Publication4
Alternative sequenceiVSP_053712244 – 327Missing in isoform 6. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_011547327S → SDLTSVSLDLPLPPPPCHYE LVLM in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF069984 Genomic DNA Translation: AAC39901.1
AF069987 mRNA Translation: AAC39907.1
CR541814 mRNA Translation: CAG46613.1
CR541846 mRNA Translation: CAG46644.1
AL591806 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52656.1
CH471121 Genomic DNA Translation: EAW52654.1
CH471121 Genomic DNA Translation: EAW52657.1
BC046149 mRNA Translation: AAH46149.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1218.1 [Q86X76-1]
CCDS53401.1 [Q86X76-5]
CCDS53402.1 [Q86X76-4]
CCDS53403.1 [Q86X76-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001172021.1, NM_001185092.1 [Q86X76-5]
NP_001172022.1, NM_001185093.1 [Q86X76-4]
NP_001172023.1, NM_001185094.1 [Q86X76-2]
NP_005591.1, NM_005600.2 [Q86X76-1]
XP_005245273.1, XM_005245216.3 [Q86X76-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000368007; ENSP00000356986; ENSG00000158793 [Q86X76-4]
ENST00000368008; ENSP00000356987; ENSG00000158793 [Q86X76-5]
ENST00000368009; ENSP00000356988; ENSG00000158793 [Q86X76-1]
ENST00000392190; ENSP00000376028; ENSG00000158793 [Q86X76-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4817

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4817

UCSC genome browser

More...
UCSCi
uc001fxv.3, human [Q86X76-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069984 Genomic DNA Translation: AAC39901.1
AF069987 mRNA Translation: AAC39907.1
CR541814 mRNA Translation: CAG46613.1
CR541846 mRNA Translation: CAG46644.1
AL591806 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52656.1
CH471121 Genomic DNA Translation: EAW52654.1
CH471121 Genomic DNA Translation: EAW52657.1
BC046149 mRNA Translation: AAH46149.1
CCDSiCCDS1218.1 [Q86X76-1]
CCDS53401.1 [Q86X76-5]
CCDS53402.1 [Q86X76-4]
CCDS53403.1 [Q86X76-2]
RefSeqiNP_001172021.1, NM_001185092.1 [Q86X76-5]
NP_001172022.1, NM_001185093.1 [Q86X76-4]
NP_001172023.1, NM_001185094.1 [Q86X76-2]
NP_005591.1, NM_005600.2 [Q86X76-1]
XP_005245273.1, XM_005245216.3 [Q86X76-2]

3D structure databases

SMRiQ86X76
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi110882, 61 interactors
IntActiQ86X76, 53 interactors
MINTiQ86X76
STRINGi9606.ENSP00000356988

Chemistry databases

ChEMBLiCHEMBL4295883

PTM databases

iPTMnetiQ86X76
PhosphoSitePlusiQ86X76

Polymorphism and mutation databases

BioMutaiNIT1
DMDMi51704324

Proteomic databases

EPDiQ86X76
jPOSTiQ86X76
MassIVEiQ86X76
MaxQBiQ86X76
PaxDbiQ86X76
PeptideAtlasiQ86X76
PRIDEiQ86X76
ProteomicsDBi70250 [Q86X76-1]
70251 [Q86X76-2]
70252 [Q86X76-3]
70253 [Q86X76-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1672, 239 antibodies

The DNASU plasmid repository

More...
DNASUi
4817

Genome annotation databases

EnsembliENST00000368007; ENSP00000356986; ENSG00000158793 [Q86X76-4]
ENST00000368008; ENSP00000356987; ENSG00000158793 [Q86X76-5]
ENST00000368009; ENSP00000356988; ENSG00000158793 [Q86X76-1]
ENST00000392190; ENSP00000376028; ENSG00000158793 [Q86X76-2]
GeneIDi4817
KEGGihsa:4817
UCSCiuc001fxv.3, human [Q86X76-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4817
DisGeNETi4817
EuPathDBiHostDB:ENSG00000158793.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NIT1
HGNCiHGNC:7828, NIT1
HPAiENSG00000158793, Low tissue specificity
MIMi604618, gene
neXtProtiNX_Q86X76
OpenTargetsiENSG00000158793
PharmGKBiPA31636

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0807, Eukaryota
GeneTreeiENSGT00550000075099
HOGENOMiCLU_030130_1_1_1
InParanoidiQ86X76
KOiK11206
OMAiMTCYDVR
OrthoDBi1154369at2759
PhylomeDBiQ86X76
TreeFamiTF313080

Enzyme and pathway databases

PathwayCommonsiQ86X76

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
4817, 4 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NIT1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4817
PharosiQ86X76, Tbio

Protein Ontology

More...
PROi
PR:Q86X76
RNActiQ86X76, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158793, Expressed in left adrenal gland and 243 other tissues
GenevisibleiQ86X76, HS

Family and domain databases

Gene3Di3.60.110.10, 1 hit
InterProiView protein in InterPro
IPR003010, C-N_Hydrolase
IPR036526, C-N_Hydrolase_sf
IPR001110, UPF0012_CS
PfamiView protein in Pfam
PF00795, CN_hydrolase, 1 hit
SUPFAMiSSF56317, SSF56317, 1 hit
PROSITEiView protein in PROSITE
PS50263, CN_HYDROLASE, 1 hit
PS01227, UPF0012, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNIT1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86X76
Secondary accession number(s): B1AQP3, D3DVF4, O76091
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: August 31, 2004
Last modified: August 12, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again