Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q86X29 (LSR_HUMAN)

Entry version 165 (11 Dec 2019)
Sequence version 4 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lipolysis-stimulated lipoprotein receptor

Gene

LSR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells (By similarity).By similarity

Caution

In contrast to the rodent orthologous protein, it is longer in N-terminus and no signal sequence is detected by any prediction method.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8964038 LDL clearance
R-HSA-8964046 VLDL clearance

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lipolysis-stimulated lipoprotein receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LSR
Synonyms:LISCH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000105699.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:29572 LSR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		616582 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q86X29

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 259ExtracellularSequence analysisAdd BLAST259
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei260 – 280HelicalSequence analysisAdd BLAST21
Topological domaini281 – 649CytoplasmicSequence analysisAdd BLAST369

Keywords - Cellular componenti

Cell membrane, Chylomicron, LDL, Membrane, VLDL

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		51599

Open Targets

More...OpenTargetsi		ENSG00000105699

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671504

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q86X29 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LSR

Domain mapping of disease mutations (DMDM)

More...DMDMi		116242622

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002453081 – 649Lipolysis-stimulated lipoprotein receptorAdd BLAST649

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi111 ↔ 218PROSITE-ProRule annotation
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei336PhosphothreonineBy similarity1
Modified residuei365PhosphoserineCombined sources1
Modified residuei371PhosphoserineCombined sources1
Modified residuei389PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei453PhosphothreonineCombined sources1
Modified residuei464PhosphoserineCombined sources1
Modified residuei467PhosphoserineCombined sources1
Modified residuei493PhosphoserineCombined sources1
Modified residuei501PhosphothreonineCombined sources1
Modified residuei528PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei535PhosphotyrosineCombined sources1
Modified residuei540PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei631PhosphoserineCombined sources1
Modified residuei643PhosphoserineCombined sources1
Modified residuei646PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q86X29

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q86X29

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q86X29

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q86X29

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q86X29

PeptideAtlas

More...PeptideAtlasi		Q86X29

PRoteomics IDEntifications database

More...PRIDEi		Q86X29

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		20511
4469
70230 [Q86X29-1]
70231 [Q86X29-2]
70232 [Q86X29-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q86X29

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q86X29

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q86X29

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000105699 Expressed in 178 organ(s), highest expression level in pigmented layer of retina

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q86X29 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q86X29 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA007270

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer or homotetramer.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		119629, 71 interactors

Protein interaction database and analysis system

More...IntActi		Q86X29, 39 interactors

Molecular INTeraction database

More...MINTi		Q86X29

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000480821

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q86X29 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini86 – 234Ig-like V-typeAdd BLAST149

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi280 – 304Cys-richAdd BLAST25

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. LISCH7 family.Curated

Keywords - Domaini

Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IKMJ Eukaryota
ENOG411004A LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183058

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000253962

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q86X29

Identification of Orthologs from Complete Genome Data

More...OMAi		EIRSGYR

Database of Orthologous Groups

More...OrthoDBi		457764at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q86X29

TreeFam database of animal gene trees

More...TreeFami		TF330877

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR003599 Ig_sub
IPR008664 LISCH7

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05624 LSR, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409 IG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86X29-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQQDGLGVGT RNGSGKGRSV HPSWPWCAPR PLRYFGRDAR ARRAQTAAMA 
        60         70         80         90        100
LLAGGLSRGL GSHPAAAGRD AVVFVWLLLS TWCTAPARAI QVTVSNPYHV 
       110        120        130        140        150
VILFQPVTLP CTYQMTSTPT QPIVIWKYKS FCRDRIADAF SPASVDNQLN 
       160        170        180        190        200
AQLAAGNPGY NPYVECQDSV RTVRVVATKQ GNAVTLGDYY QGRRITITGN 
       210        220        230        240        250
ADLTFDQTAW GDSGVYYCSV VSAQDLQGNN EAYAELIVLG RTSGVAELLP 
       260        270        280        290        300
GFQAGPIEDW LFVVVVCLAA FLIFLLLGIC WCQCCPHTCC CYVRCPCCPD 
       310        320        330        340        350
KCCCPEALYA AGKAATSGVP SIYAPSTYAH LSPAKTPPPP AMIPMGPAYN 
       360        370        380        390        400
GYPGGYPGDV DRSSSAGGQG SYVPLLRDTD SSVASEVRSG YRIQASQQDD 
       410        420        430        440        450
SMRVLYYMEK ELANFDPSRP GPPSGRVERA MSEVTSLHED DWRSRPSRGP 
       460        470        480        490        500
ALTPIRDEEW GGHSPRSPRG WDQEPAREQA GGGWRARRPR ARSVDALDDL 
       510        520        530        540        550
TPPSTAESGS RSPTSNGGRS RAYMPPRSRS RDDLYDQDDS RDFPRSRDPH 
       560        570        580        590        600
YDDFRSRERP PADPRSHHHR TRDPRDNGSR SGDLPYDGRL LEEAVRKKGS 
       610        620        630        640 
EERRRPHKEE EEEAYYPPAP PPYSETDSQA SRERRLKKNL ALSRESLVV
Length:649
Mass (Da):71,439
Last modified:October 17, 2006 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i01E8F1CE0197CE9B
GO
Isoform 2 (identifier: Q86X29-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-88: Missing.
     366-386: Missing.

Show »
Length:591
Mass (Da):65,587
Checksum:iE254FA92B362D418
GO
Isoform 3 (identifier: Q86X29-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-258: Missing.
     386-386: Missing.

Show »
Length:629
Mass (Da):69,429
Checksum:i32D531E33D09464E
GO
Isoform 4 (identifier: Q86X29-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-258: Missing.

Show »
Length:630
Mass (Da):69,558
Checksum:i2569488B01545053
GO
Isoform 5 (identifier: Q86X29-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-308: GRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL → V

Show »
Length:581
Mass (Da):64,053
Checksum:iED8EC7A3B3BDB8D3
GO
Isoform 6 (identifier: Q86X29-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.
     200-308: NADLTFDQTA...PDKCCCPEAL → M

Show »
Length:493
Mass (Da):54,498
Checksum:i8C0EDAF2784F9FCF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3V8S4R3V8_HUMAN
Lipolysis-stimulated lipoprotein re...
LSR
601Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0W1M0R0W1_HUMAN
Lipolysis-stimulated lipoprotein re...
LSR
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZL9M0QZL9_HUMAN
Lipolysis-stimulated lipoprotein re...
LSR
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1W9M0R1W9_HUMAN
Lipolysis-stimulated lipoprotein re...
LSR
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB51178 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAB58317 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAH04381 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti259D → G in AAB51178 (PubMed:15057824).Curated1
Sequence conflicti308L → R in AAB51178 (PubMed:15057824).Curated1
Sequence conflicti430A → G in AAB51178 (PubMed:15057824).Curated1
Sequence conflicti518G → GR in BAC86714 (PubMed:14702039).Curated1
Sequence conflicti518G → GR in BAC11614 (PubMed:16303743).Curated1
Sequence conflicti518G → GR in AAH04381 (PubMed:15489334).Curated1
Sequence conflicti639N → D in AAB51178 (PubMed:15057824).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049902363S → N2 PublicationsCorresponds to variant dbSNP:rs34259399Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0572101 – 48Missing in isoform 6. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_01969152 – 88Missing in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_057211200 – 308NADLT…CPEAL → M in isoform 6. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_046797240 – 308GRTSG…CPEAL → V in isoform 5. CuratedAdd BLAST69
Alternative sequenceiVSP_019692240 – 258Missing in isoform 3 and isoform 4. 3 PublicationsAdd BLAST19
Alternative sequenceiVSP_019693366 – 386Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_019694386Missing in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF130366 mRNA Translation: AAD22101.1
AK075426 mRNA Translation: BAC11614.1
AK126834 mRNA Translation: BAC86714.1
AK296618 mRNA Translation: BAG59226.1
AC002128 Genomic DNA Translation: AAB58317.1 Sequence problems.
AD000684 Genomic DNA Translation: AAB51178.1 Sequence problems.
BC004381 mRNA Translation: AAH04381.2 Different initiation.
BC047376 mRNA Translation: AAH47376.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12449.1 [Q86X29-4]
CCDS12450.1 [Q86X29-1]
CCDS12451.1 [Q86X29-5]
CCDS59376.1 [Q86X29-3]

NCBI Reference Sequences

More...RefSeqi		NP_001247418.1, NM_001260489.1 [Q86X29-3]
NP_001247419.1, NM_001260490.1
NP_057009.3, NM_015925.6 [Q86X29-4]
NP_991403.1, NM_205834.3 [Q86X29-1]
NP_991404.1, NM_205835.3 [Q86X29-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000347609; ENSP00000262627; ENSG00000105699 [Q86X29-2]
ENST00000354900; ENSP00000346976; ENSG00000105699 [Q86X29-4]
ENST00000360798; ENSP00000354034; ENSG00000105699 [Q86X29-5]
ENST00000361790; ENSP00000354575; ENSG00000105699 [Q86X29-1]
ENST00000427250; ENSP00000394479; ENSG00000105699 [Q86X29-6]
ENST00000602122; ENSP00000472569; ENSG00000105699 [Q86X29-3]
ENST00000621372; ENSP00000480821; ENSG00000105699 [Q86X29-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		51599

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:51599

UCSC genome browser

More...UCSCi		uc002nyl.4 human [Q86X29-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF130366 mRNA Translation: AAD22101.1
AK075426 mRNA Translation: BAC11614.1
AK126834 mRNA Translation: BAC86714.1
AK296618 mRNA Translation: BAG59226.1
AC002128 Genomic DNA Translation: AAB58317.1 Sequence problems.
AD000684 Genomic DNA Translation: AAB51178.1 Sequence problems.
BC004381 mRNA Translation: AAH04381.2 Different initiation.
BC047376 mRNA Translation: AAH47376.2
CCDSiCCDS12449.1 [Q86X29-4]
CCDS12450.1 [Q86X29-1]
CCDS12451.1 [Q86X29-5]
CCDS59376.1 [Q86X29-3]
RefSeqiNP_001247418.1, NM_001260489.1 [Q86X29-3]
NP_001247419.1, NM_001260490.1
NP_057009.3, NM_015925.6 [Q86X29-4]
NP_991403.1, NM_205834.3 [Q86X29-1]
NP_991404.1, NM_205835.3 [Q86X29-5]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi119629, 71 interactors
IntActiQ86X29, 39 interactors
MINTiQ86X29
STRINGi9606.ENSP00000480821

PTM databases

iPTMnetiQ86X29
PhosphoSitePlusiQ86X29
SwissPalmiQ86X29

Polymorphism and mutation databases

BioMutaiLSR
DMDMi116242622

Proteomic databases

EPDiQ86X29
jPOSTiQ86X29
MassIVEiQ86X29
MaxQBiQ86X29
PaxDbiQ86X29
PeptideAtlasiQ86X29
PRIDEiQ86X29
ProteomicsDBi20511
4469
70230 [Q86X29-1]
70231 [Q86X29-2]
70232 [Q86X29-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		51599

Genome annotation databases

EnsembliENST00000347609; ENSP00000262627; ENSG00000105699 [Q86X29-2]
ENST00000354900; ENSP00000346976; ENSG00000105699 [Q86X29-4]
ENST00000360798; ENSP00000354034; ENSG00000105699 [Q86X29-5]
ENST00000361790; ENSP00000354575; ENSG00000105699 [Q86X29-1]
ENST00000427250; ENSP00000394479; ENSG00000105699 [Q86X29-6]
ENST00000602122; ENSP00000472569; ENSG00000105699 [Q86X29-3]
ENST00000621372; ENSP00000480821; ENSG00000105699 [Q86X29-1]
GeneIDi51599
KEGGihsa:51599
UCSCiuc002nyl.4 human [Q86X29-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		51599
DisGeNETi51599
EuPathDBiHostDB:ENSG00000105699.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		LSR
HGNCiHGNC:29572 LSR
HPAiHPA007270
MIMi616582 gene
neXtProtiNX_Q86X29
OpenTargetsiENSG00000105699
PharmGKBiPA142671504

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IKMJ Eukaryota
ENOG411004A LUCA
GeneTreeiENSGT00950000183058
HOGENOMiHOG000253962
InParanoidiQ86X29
OMAiEIRSGYR
OrthoDBi457764at2759
PhylomeDBiQ86X29
TreeFamiTF330877

Enzyme and pathway databases

ReactomeiR-HSA-8964038 LDL clearance
R-HSA-8964046 VLDL clearance

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		LSR human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		LSR_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		51599
PharosiQ86X29 Tbio

Protein Ontology

More...PROi		PR:Q86X29
RNActiQ86X29 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000105699 Expressed in 178 organ(s), highest expression level in pigmented layer of retina
ExpressionAtlasiQ86X29 baseline and differential
GenevisibleiQ86X29 HS

Family and domain databases

InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR003599 Ig_sub
IPR008664 LISCH7
PfamiView protein in Pfam
PF05624 LSR, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLSR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86X29
Secondary accession number(s): A6NDW3
, B4DKL4, E9PHD4, O00112, O00426, Q6ZT80, Q8NBM0, Q9BT33, Q9UQL3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: October 17, 2006
Last modified: December 11, 2019
This is version 165 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again