Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (08 May 2019)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Poly(ADP-ribose) glycohydrolase

Gene

PARG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Poly(ADP-ribose) glycohydrolase that degrades poly(ADP-ribose) by hydrolyzing the ribose-ribose bonds present in poly(ADP-ribose) (PubMed:21892188, PubMed:23102699, PubMed:23474714). PARG acts both as an endo- and exoglycosidase, releasing poly(ADP-ribose) of different length as well as ADP-ribose monomers (PubMed:23102699, PubMed:23481255). It is however unable to cleave the ester bond between the terminal ADP-ribose and ADP-ribosylated residues, leaving proteins that are mono-ADP-ribosylated (PubMed:21892188, PubMed:23474714). Poly(ADP-ribose) is synthesized after DNA damage is only present transiently and is rapidly degraded by PARG (PubMed:23102699). Required to prevent detrimental accumulation of poly(ADP-ribose) upon prolonged replicative stress, while it is not required for recovery from transient replicative stress (PubMed:24906880). Required for retinoid acid-dependent gene transactivation, probably by removing poly(ADP-ribose) from histone demethylase KDM4D, allowing chromatin derepression at RAR-dependent gene promoters (PubMed:23102699). Involved in the synthesis of ATP in the nucleus, together with PARP1, NMNAT1 and NUDT5 (PubMed:27257257). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (PubMed:27257257).6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei7371 Publication1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei740Substrate2 Publications1
Binding sitei754Substrate; via amide nitrogen2 Publications1
Active sitei7552 Publications1
Active sitei7562 Publications1
Binding sitei795SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processDNA damage

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.2.1.143 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-110362 POLB-Dependent Long Patch Base Excision Repair

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Poly(ADP-ribose) glycohydrolase1 Publication (EC:3.2.1.1432 Publications)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PARG1 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8605 PARG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603501 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86W56

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi12K → A: Abolishes nuclear targeting; when associated with G-13. 1 Publication1
Mutagenesisi13R → G: Abolishes nuclear targeting; when associated with A-12. 1 Publication1
Mutagenesisi36R → A: No effect. 1 Publication1
Mutagenesisi37R → G: No effect. 1 Publication1
Mutagenesisi740N → A: Reduced poly(ADP-ribose) glycohydrolase activity. 1 Publication1
Mutagenesisi755E → A: Abolished poly(ADP-ribose) glycohydrolase activity. 1 Publication1
Mutagenesisi756E → A: Abolished poly(ADP-ribose) glycohydrolase activity. 1 Publication1
Mutagenesisi874A → W: Reduced poly(ADP-ribose) glycohydrolase activity. 1 Publication1
Mutagenesisi875F → A: Abolished poly(ADP-ribose) glycohydrolase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
670
8505

Open Targets

More...
OpenTargetsi
ENSG00000227345

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA32940

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1795143

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PARG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
56417893

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000666021 – 976Poly(ADP-ribose) glycohydrolaseAdd BLAST976

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei22PhosphoserineCombined sources1
Modified residuei68PhosphoserineCombined sources1
Modified residuei133PhosphoserineCombined sources1
Modified residuei137PhosphoserineCombined sources1
Modified residuei139PhosphothreonineCombined sources1
Modified residuei197PhosphoserineCombined sources1 Publication1
Modified residuei199PhosphothreonineCombined sources1 Publication1
Modified residuei261PhosphoserineCombined sources1
Modified residuei264PhosphoserineCombined sources1
Modified residuei286PhosphoserineCombined sources1
Modified residuei291PhosphoserineCombined sources1
Modified residuei298Phosphoserine1 Publication1
Modified residuei302PhosphoserineCombined sources1
Modified residuei316PhosphoserineCombined sources1
Modified residuei340N6-acetyllysineBy similarity1
Modified residuei448PhosphoserineCombined sources1
Isoform 2 (identifier: Q86W56-2)
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86W56

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86W56

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86W56

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86W56

PeptideAtlas

More...
PeptideAtlasi
Q86W56

PRoteomics IDEntifications database

More...
PRIDEi
Q86W56

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70121
70122 [Q86W56-2]
70123 [Q86W56-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86W56

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86W56

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q86W56

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000227345 Expressed in 200 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86W56 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86W56 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA021819
HPA053007

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PCNA (PubMed:21398629). Interacts with NUDT5 (PubMed:27257257).2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114077, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q86W56, 3 interactors

Molecular INTeraction database

More...
MINTi
Q86W56

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000384408

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q86W56

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1976
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4A0DX-ray1.75A448-976[»]
4B1GX-ray1.83A448-976[»]
4B1HX-ray2.00A448-976[»]
4B1IX-ray2.14A448-976[»]
4B1JX-ray2.08A448-976[»]
5A7RX-ray1.95A448-976[»]
5LHBX-ray2.23A448-976[»]
6HH6X-ray1.85A448-976[»]
6HMKX-ray2.06A448-976[»]
6HMLX-ray2.25A448-976[»]
6HMMX-ray1.90A448-976[»]
6HMNX-ray2.87A448-976[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86W56

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 456A-domain1 PublicationAdd BLAST456
Regioni610 – 795Catalytic1 PublicationAdd BLAST186
Regioni726 – 727Substrate binding2 Publications2
Regioni869 – 874Substrate binding2 Publications6

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi10 – 16Nuclear localization signal1 Publication7
Motifi76 – 83PIP-box (PCNA interacting peptide)1 Publication8

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PIP-box mediates interaction with PCNA and localization to replication foci.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2064 Eukaryota
ENOG410XT3Y LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003652

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86W56

KEGG Orthology (KO)

More...
KOi
K07759

Identification of Orthologs from Complete Genome Data

More...
OMAi
DIYSMHI

Database of Orthologous Groups

More...
OrthoDBi
1061420at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86W56

TreeFam database of animal gene trees

More...
TreeFami
TF323527

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007724 Poly_GlycHdrlase

The PANTHER Classification System

More...
PANTHERi
PTHR12837 PTHR12837, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05028 PARG_cat, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86W56-1) [UniParc]FASTAAdd to basket
Also known as: hPARG111

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNAGPGCEPC TKRPRWGAAT TSPAASDARS FPSRQRRVLD PKDAHVQFRV
60 70 80 90 100
PPSSPACVPG RAGQHRGSAT SLVFKQKTIT SWMDTKGIKT AESESLDSKE
110 120 130 140 150
NNNTRIESMM SSVQKDNFYQ HNVEKLENVS QLSLDKSPTE KSTQYLNQHQ
160 170 180 190 200
TAAMCKWQNE GKHTEQLLES EPQTVTLVPE QFSNANIDRS PQNDDHSDTD
210 220 230 240 250
SEENRDNQQF LTTVKLANAK QTTEDEQARE AKSHQKCSKS CDPGEDCASC
260 270 280 290 300
QQDEIDVVPE SPLSDVGSED VGTGPKNDNK LTRQESCLGN SPPFEKESEP
310 320 330 340 350
ESPMDVDNSK NSCQDSEADE ETSPGFDEQE DGSSSQTANK PSRFQARDAD
360 370 380 390 400
IEFRKRYSTK GGEVRLHFQF EGGESRTGMN DLNAKLPGNI SSLNVECRNS
410 420 430 440 450
KQHGKKDSKI TDHFMRLPKA EDRRKEQWET KHQRTERKIP KYVPPHLSPD
460 470 480 490 500
KKWLGTPIEE MRRMPRCGIR LPLLRPSANH TVTIRVDLLR AGEVPKPFPT
510 520 530 540 550
HYKDLWDNKH VKMPCSEQNL YPVEDENGER TAGSRWELIQ TALLNKFTRP
560 570 580 590 600
QNLKDAILKY NVAYSKKWDF TALIDFWDKV LEEAEAQHLY QSILPDMVKI
610 620 630 640 650
ALCLPNICTQ PIPLLKQKMN HSITMSQEQI ASLLANAFFC TFPRRNAKMK
660 670 680 690 700
SEYSSYPDIN FNRLFEGRSS RKPEKLKTLF CYFRRVTEKK PTGLVTFTRQ
710 720 730 740 750
SLEDFPEWER CEKPLTRLHV TYEGTIEENG QGMLQVDFAN RFVGGGVTSA
760 770 780 790 800
GLVQEEIRFL INPELIISRL FTEVLDHNEC LIITGTEQYS EYTGYAETYR
810 820 830 840 850
WSRSHEDGSE RDDWQRRCTE IVAIDALHFR RYLDQFVPEK MRRELNKAYC
860 870 880 890 900
GFLRPGVSSE NLSAVATGNW GCGAFGGDAR LKALIQILAA AAAERDVVYF
910 920 930 940 950
TFGDSELMRD IYSMHIFLTE RKLTVGDVYK LLLRYYNEEC RNCSTPGPDI
960 970
KLYPFIYHAV ESCAETADHS GQRTGT
Length:976
Mass (Da):111,110
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD6646353C6D0180E
GO
Isoform 2 (identifier: Q86W56-2) [UniParc]FASTAAdd to basket
Also known as: hPARG102

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.

Show »
Length:894
Mass (Da):102,312
Checksum:i666B77E891E4A500
GO
Isoform 3 (identifier: Q86W56-3) [UniParc]FASTAAdd to basket
Also known as: hPARG99

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.

Show »
Length:868
Mass (Da):99,432
Checksum:i85BCE7201ABABA5F
GO
Isoform 4 (identifier: Q86W56-4) [UniParc]FASTAAdd to basket
Also known as: hPARG60

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MNAGPGCEPCTKRPR → MVQAGAEKDAQSISL
     16-423: Missing.
     485-526: RVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDE → W

Note: Catalytically inactive.
Show »
Length:527
Mass (Da):60,873
Checksum:i0FBB26152C56D33D
GO
Isoform 5 (identifier: Q86W56-5) [UniParc]FASTAAdd to basket
Also known as: hPARG55

The sequence of this isoform differs from the canonical sequence as follows:
     1-460: Missing.
     485-526: RVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDE → W

Note: Catalytically inactive.
Show »
Length:475
Mass (Da):54,794
Checksum:i5443EFFA21AA84CE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WXI6A0A087WXI6_HUMAN
Poly(ADP-ribose) glycohydrolase
PARG
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WX07A0A087WX07_HUMAN
Poly(ADP-ribose) glycohydrolase
PARG
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti13 – 14RP → AT in AAB61614 (PubMed:10449915).Curated2
Sequence conflicti61R → Q in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti127E → V in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti138P → L in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti227Q → H in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti242D → H in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti260E → K in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti275P → S in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti282T → I in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti414F → L in AAB61614 (PubMed:10449915).Curated1
Sequence conflicti466R → Q in AFM56043 (PubMed:22433848).Curated1
Sequence conflicti484I → V in AFM56043 (PubMed:22433848).Curated1
Sequence conflicti814 – 815WQ → CE in AAB61614 (PubMed:10449915).Curated2
Sequence conflicti817R → H in AAH52966 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0446741 – 460Missing in isoform 5. 1 PublicationAdd BLAST460
Alternative sequenceiVSP_0117701 – 108Missing in isoform 3. 2 PublicationsAdd BLAST108
Alternative sequenceiVSP_0117691 – 82Missing in isoform 2. 2 PublicationsAdd BLAST82
Alternative sequenceiVSP_0446751 – 15MNAGP…TKRPR → MVQAGAEKDAQSISL in isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_04467616 – 423Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_044677485 – 526RVDLL…PVEDE → W in isoform 4 and isoform 5. 2 PublicationsAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY258587 mRNA Translation: AAP83314.1
AY575848 mRNA Translation: AAT66421.1
AY575849 mRNA Translation: AAT66422.1
AF005043 mRNA Translation: AAB61614.1
EF382674 mRNA Translation: ABR10027.1
JQ890226 mRNA Translation: AFM56043.1
AK295786 mRNA Translation: BAG58607.1
AK302560 mRNA Translation: BAG63826.1
AK314909 mRNA Translation: BAG37421.1
BC050560 mRNA Translation: AAH50560.1
BC052966 mRNA Translation: AAH52966.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73130.1 [Q86W56-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001289706.1, NM_001302777.1
NP_001290415.1, NM_001303486.1 [Q86W56-2]
NP_001290416.1, NM_001303487.1 [Q86W56-3]
NP_001311310.1, NM_001324381.1 [Q86W56-2]
NP_003622.2, NM_003631.3 [Q86W56-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000402038; ENSP00000384408; ENSG00000227345 [Q86W56-1]
ENST00000616448; ENSP00000484285; ENSG00000227345 [Q86W56-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
670
8505

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8505

UCSC genome browser

More...
UCSCi
uc057tfe.1 human [Q86W56-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY258587 mRNA Translation: AAP83314.1
AY575848 mRNA Translation: AAT66421.1
AY575849 mRNA Translation: AAT66422.1
AF005043 mRNA Translation: AAB61614.1
EF382674 mRNA Translation: ABR10027.1
JQ890226 mRNA Translation: AFM56043.1
AK295786 mRNA Translation: BAG58607.1
AK302560 mRNA Translation: BAG63826.1
AK314909 mRNA Translation: BAG37421.1
BC050560 mRNA Translation: AAH50560.1
BC052966 mRNA Translation: AAH52966.1
CCDSiCCDS73130.1 [Q86W56-1]
RefSeqiNP_001289706.1, NM_001302777.1
NP_001290415.1, NM_001303486.1 [Q86W56-2]
NP_001290416.1, NM_001303487.1 [Q86W56-3]
NP_001311310.1, NM_001324381.1 [Q86W56-2]
NP_003622.2, NM_003631.3 [Q86W56-1]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4A0DX-ray1.75A448-976[»]
4B1GX-ray1.83A448-976[»]
4B1HX-ray2.00A448-976[»]
4B1IX-ray2.14A448-976[»]
4B1JX-ray2.08A448-976[»]
5A7RX-ray1.95A448-976[»]
5LHBX-ray2.23A448-976[»]
6HH6X-ray1.85A448-976[»]
6HMKX-ray2.06A448-976[»]
6HMLX-ray2.25A448-976[»]
6HMMX-ray1.90A448-976[»]
6HMNX-ray2.87A448-976[»]
SMRiQ86W56
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114077, 8 interactors
IntActiQ86W56, 3 interactors
MINTiQ86W56
STRINGi9606.ENSP00000384408

Chemistry databases

BindingDBiQ86W56
ChEMBLiCHEMBL1795143

PTM databases

iPTMnetiQ86W56
PhosphoSitePlusiQ86W56

Polymorphism and mutation databases

BioMutaiPARG
DMDMi56417893

Proteomic databases

EPDiQ86W56
jPOSTiQ86W56
MaxQBiQ86W56
PaxDbiQ86W56
PeptideAtlasiQ86W56
PRIDEiQ86W56
ProteomicsDBi70121
70122 [Q86W56-2]
70123 [Q86W56-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000402038; ENSP00000384408; ENSG00000227345 [Q86W56-1]
ENST00000616448; ENSP00000484285; ENSG00000227345 [Q86W56-1]
GeneIDi670
8505
KEGGihsa:8505
UCSCiuc057tfe.1 human [Q86W56-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
670
8505
DisGeNETi670
8505

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PARG

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0127080
HGNCiHGNC:8605 PARG
HPAiHPA021819
HPA053007
MIMi603501 gene
neXtProtiNX_Q86W56
OpenTargetsiENSG00000227345
PharmGKBiPA32940

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2064 Eukaryota
ENOG410XT3Y LUCA
GeneTreeiENSGT00390000003652
InParanoidiQ86W56
KOiK07759
OMAiDIYSMHI
OrthoDBi1061420at2759
PhylomeDBiQ86W56
TreeFamiTF323527

Enzyme and pathway databases

BRENDAi3.2.1.143 2681
ReactomeiR-HSA-110362 POLB-Dependent Long Patch Base Excision Repair

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PARG human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PARG
PMAP-CutDBiQ86W56

Protein Ontology

More...
PROi
PR:Q86W56

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000227345 Expressed in 200 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ86W56 baseline and differential
GenevisibleiQ86W56 HS

Family and domain databases

InterProiView protein in InterPro
IPR007724 Poly_GlycHdrlase
PANTHERiPTHR12837 PTHR12837, 1 hit
PfamiView protein in Pfam
PF05028 PARG_cat, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPARG_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86W56
Secondary accession number(s): A5YBK3
, B2RC24, B4DIU5, B4DYR4, I6RUV3, Q6E4P6, Q6E4P7, Q7Z742, Q9Y4W7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2004
Last sequence update: June 1, 2003
Last modified: May 8, 2019
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again