Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 139 (16 Oct 2019)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transmembrane protein adipocyte-associated 1

Gene

TPRA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein adipocyte-associated 1
Alternative name(s):
Integral membrane protein GPR175
Transmembrane protein 227
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TPRA1
Synonyms:GPR175, TMEM227
ORF Names:PP6566
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30413 TPRA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608336 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86W33

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei48 – 68Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei76 – 96Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei123 – 143Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei151 – 171Helical; Name=4Sequence analysisAdd BLAST21
Transmembranei192 – 212Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei234 – 254Helical; Name=6Sequence analysisAdd BLAST21
Transmembranei265 – 285Helical; Name=7Sequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
131601

Open Targets

More...
OpenTargetsi
ENSG00000163870

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165698543

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86W33

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TPRA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74727643

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000760991 – 373Transmembrane protein adipocyte-associated 1Add BLAST373

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi11N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi23N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi361N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86W33

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86W33

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86W33

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86W33

PeptideAtlas

More...
PeptideAtlasi
Q86W33

PRoteomics IDEntifications database

More...
PRIDEi
Q86W33

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
70108 [Q86W33-1]
70109 [Q86W33-2]
70110 [Q86W33-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86W33

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86W33

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous, with higher levels in heart, placenta and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163870 Expressed in 188 organ(s), highest expression level in ectocervix

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86W33 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86W33 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019784

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
NLGN3Q9NZ94-23EBI-16424742,EBI-16423037

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126289, 32 interactors

Protein interaction database and analysis system

More...
IntActi
Q86W33, 25 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000347748

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UPF0359 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4536 Eukaryota
ENOG410XRXY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016807

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112778

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86W33

KEGG Orthology (KO)

More...
KOi
K22988

Identification of Orthologs from Complete Genome Data

More...
OMAi
GGMLFWF

Database of Orthologous Groups

More...
OrthoDBi
948626at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86W33

TreeFam database of animal gene trees

More...
TreeFami
TF314072

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018781 TPRA1/CAND2/CAND8

The PANTHER Classification System

More...
PANTHERi
PTHR15876 PTHR15876, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10160 Tmemb_40, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86W33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDTLEEVTWA NGSTALPPPL APNISVPHRC LLLLYEDIGT SRVRYWDLLL
60 70 80 90 100
LIPNVLFLIF LLWKLPSARA KIRITSSPIF ITFYILVFVV ALVGIARAVV
110 120 130 140 150
SMTVSTSNAA TVADKILWEI TRFFLLAIEL SVIILGLAFG HLESKSSIKR
160 170 180 190 200
VLAITTVLSL AYSVTQGTLE ILYPDAHLSA EDFNIYGHGG RQFWLVSSCF
210 220 230 240 250
FFLVYSLVVI LPKTPLKERI SLPSRRSFYV YAGILALLNL LQGLGSVLLC
260 270 280 290 300
FDIIEGLCCV DATTFLYFSF FAPLIYVAFL RGFFGSEPKI LFSYKCQVDE
310 320 330 340 350
TEEPDVHLPQ PYAVARREGL EAAGAAGASA ASYSSTQFDS AGGVAYLDDI
360 370
ASMPCHTGSI NSTDSERWKA INA
Length:373
Mass (Da):41,053
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDDD489CBB98EAF1A
GO
Isoform 2 (identifier: Q86W33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-239: VYSLVVILPKTPLKERISLPSRRSFYVYAGILALLN → LGGASTCMRASWHCSTYCRGWGVCCCASTSSRGSAV
     240-373: Missing.

Show »
Length:239
Mass (Da):26,289
Checksum:i395AE297B79DF2D2
GO
Isoform 3 (identifier: Q86W33-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-293: VYSLVVILPK...FGSEPKILFS → LCRCHNLPVL...RLCRRGGLPG
     294-373: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,117
Checksum:i1EA2891404AAE4F5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JU06C9JU06_HUMAN
Transmembrane protein adipocyte-ass...
TPRA1
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZ00C9JZ00_HUMAN
Transmembrane protein adipocyte-ass...
TPRA1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC44F8WC44_HUMAN
Transmembrane protein adipocyte-ass...
TPRA1
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JVW5C9JVW5_HUMAN
Transmembrane protein adipocyte-ass...
TPRA1
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti141 – 142HL → TW in BAA89782 (Ref. 1) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016934204 – 293VYSLV…KILFS → LCRCHNLPVLQLLRSAHLRG FPPGLLRLGAQDPLLLQMPS GRDRGARCTPTPALRCGPAG GPGGCRGCWGLSCQLLEHAV RLCRRGGLPG in isoform 3. 1 PublicationAdd BLAST90
Alternative sequenceiVSP_016932204 – 239VYSLV…LALLN → LGGASTCMRASWHCSTYCRG WGVCCCASTSSRGSAV in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_016933240 – 373Missing in isoform 2. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_016935294 – 373Missing in isoform 3. 1 PublicationAdd BLAST80

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB037108 mRNA Translation: BAA89782.1
AF289568 mRNA Translation: AAL55752.1
AC023593 Genomic DNA No translation available.
AC084035 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79343.1
CH471052 Genomic DNA Translation: EAW79344.1
BC017058 mRNA Translation: AAH17058.1
BC050711 mRNA Translation: AAH50711.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3042.1 [Q86W33-1]
CCDS46899.1 [Q86W33-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001129525.1, NM_001136053.2 [Q86W33-1]
NP_001136118.1, NM_001142646.2 [Q86W33-3]
XP_006713558.1, XM_006713495.3
XP_006713559.1, XM_006713496.2 [Q86W33-1]
XP_006713560.1, XM_006713497.3
XP_011510724.1, XM_011512422.1
XP_016861196.1, XM_017005707.1
XP_016861197.1, XM_017005708.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296210; ENSP00000296210; ENSG00000163870 [Q86W33-3]
ENST00000355552; ENSP00000347748; ENSG00000163870 [Q86W33-1]
ENST00000393400; ENSP00000377056; ENSG00000163870 [Q86W33-2]
ENST00000450633; ENSP00000413428; ENSG00000163870 [Q86W33-1]
ENST00000489960; ENSP00000418298; ENSG00000163870 [Q86W33-1]
ENST00000648957; ENSP00000498161; ENSG00000163870 [Q86W33-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
131601

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:131601

UCSC genome browser

More...
UCSCi
uc003ejn.4 human [Q86W33-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037108 mRNA Translation: BAA89782.1
AF289568 mRNA Translation: AAL55752.1
AC023593 Genomic DNA No translation available.
AC084035 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79343.1
CH471052 Genomic DNA Translation: EAW79344.1
BC017058 mRNA Translation: AAH17058.1
BC050711 mRNA Translation: AAH50711.1
CCDSiCCDS3042.1 [Q86W33-1]
CCDS46899.1 [Q86W33-3]
RefSeqiNP_001129525.1, NM_001136053.2 [Q86W33-1]
NP_001136118.1, NM_001142646.2 [Q86W33-3]
XP_006713558.1, XM_006713495.3
XP_006713559.1, XM_006713496.2 [Q86W33-1]
XP_006713560.1, XM_006713497.3
XP_011510724.1, XM_011512422.1
XP_016861196.1, XM_017005707.1
XP_016861197.1, XM_017005708.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi126289, 32 interactors
IntActiQ86W33, 25 interactors
STRINGi9606.ENSP00000347748

PTM databases

iPTMnetiQ86W33
PhosphoSitePlusiQ86W33

Polymorphism and mutation databases

BioMutaiTPRA1
DMDMi74727643

Proteomic databases

jPOSTiQ86W33
MassIVEiQ86W33
MaxQBiQ86W33
PaxDbiQ86W33
PeptideAtlasiQ86W33
PRIDEiQ86W33
ProteomicsDBi70108 [Q86W33-1]
70109 [Q86W33-2]
70110 [Q86W33-3]

Genome annotation databases

EnsembliENST00000296210; ENSP00000296210; ENSG00000163870 [Q86W33-3]
ENST00000355552; ENSP00000347748; ENSG00000163870 [Q86W33-1]
ENST00000393400; ENSP00000377056; ENSG00000163870 [Q86W33-2]
ENST00000450633; ENSP00000413428; ENSG00000163870 [Q86W33-1]
ENST00000489960; ENSP00000418298; ENSG00000163870 [Q86W33-1]
ENST00000648957; ENSP00000498161; ENSG00000163870 [Q86W33-1]
GeneIDi131601
KEGGihsa:131601
UCSCiuc003ejn.4 human [Q86W33-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
131601
DisGeNETi131601

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TPRA1
HGNCiHGNC:30413 TPRA1
HPAiHPA019784
MIMi608336 gene
neXtProtiNX_Q86W33
OpenTargetsiENSG00000163870
PharmGKBiPA165698543

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4536 Eukaryota
ENOG410XRXY LUCA
GeneTreeiENSGT00390000016807
HOGENOMiHOG000112778
InParanoidiQ86W33
KOiK22988
OMAiGGMLFWF
OrthoDBi948626at2759
PhylomeDBiQ86W33
TreeFamiTF314072

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TPRA1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
131601
PharosiQ86W33

Protein Ontology

More...
PROi
PR:Q86W33

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163870 Expressed in 188 organ(s), highest expression level in ectocervix
ExpressionAtlasiQ86W33 baseline and differential
GenevisibleiQ86W33 HS

Family and domain databases

InterProiView protein in InterPro
IPR018781 TPRA1/CAND2/CAND8
PANTHERiPTHR15876 PTHR15876, 1 hit
PfamiView protein in Pfam
PF10160 Tmemb_40, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPRA1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86W33
Secondary accession number(s): A8MVB8
, D3DNA9, Q8WZ24, Q96AJ6, Q9P2R4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: June 1, 2003
Last modified: October 16, 2019
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again