Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (16 Oct 2019)
Sequence version 1 (01 Jun 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger and SCAN domain-containing protein 30

Gene

ZSCAN30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri301 – 323C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri329 – 351C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri357 – 379C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri385 – 407C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri413 – 435C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri469 – 491C2H2-type 7PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 30
Alternative name(s):
ZNF-WYM
Zinc finger protein 397 opposite strand
Zinc finger protein 397OS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZSCAN30
Synonyms:ZNF397OS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:33517 ZSCAN30

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86W11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000186814

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165429212

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86W11

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZSCAN30

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74759452

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003006941 – 494Zinc finger and SCAN domain-containing protein 30Add BLAST494

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki197Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86W11

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86W11

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86W11

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86W11

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86W11

PeptideAtlas

More...
PeptideAtlasi
Q86W11

PRoteomics IDEntifications database

More...
PRIDEi
Q86W11

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
70101 [Q86W11-1]
70102 [Q86W11-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86W11

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86W11

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186814 Expressed in 196 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86W11 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86W11 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007289

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
755850, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q86W11, 12 interactors

Molecular INTeraction database

More...
MINTi
Q86W11

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000392371

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86W11

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini48 – 130SCAN boxPROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri301 – 323C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri329 – 351C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri357 – 379C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri385 – 407C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri413 – 435C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri469 – 491C2H2-type 7PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162162

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86W11

KEGG Orthology (KO)

More...
KOi
K09230

Identification of Orthologs from Complete Genome Data

More...
OMAi
GMIWKEM

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86W11

TreeFam database of animal gene trees

More...
TreeFami
TF338304

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07936 SCAN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.4020.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 6 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 7 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86W11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGEATVLAY HAPEEQEGLL VVKVEEENYV LDQDFGLQEN PWSQEVFRQK
60 70 80 90 100
FRQFSYSDST GPREALSRLR ELCCQWLRPE VHSKEQILEL LMLEQFLAIL
110 120 130 140 150
PEELQAWLRE HRPENGEEAV TMLEELEKEL EEPRQQDTTH GQEMFWQEMT
160 170 180 190 200
STGALKSLSL NSPVQPLENQ CKTETQESQA FQERDGRMVA GKVLMAKQEI
210 220 230 240 250
VECVASAAMI SPGKLPGETH SQRIAEEALG GLDNSKKQKG NAAGNKISQL
260 270 280 290 300
PSQDRHFSLA TFNRRIPTEH SVLESHESEG SFSMNSNDIT QQSVDTREKL
310 320 330 340 350
YECFDCGKAF CQSSKLIRHQ RIHTGERPYA CKECGKAFSL SSDLVRHQRI
360 370 380 390 400
HSGEKPYECC ECGKAFRGSS ELIRHRRIHT GEKPYECGEC GKAFSRSSAL
410 420 430 440 450
IQHKKIHTGD KSYECIACGK AFGRSSILIE HQRIHTGEKP YECNECGKSF
460 470 480 490
NQSSALTQHQ RIHTGEKPYE CSECRKTFRH RSGLMQHQRT HTRV
Length:494
Mass (Da):56,364
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i04D07EE957654505
GO
Isoform 2 (identifier: Q86W11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-221: RMVAGKVLMAKQEIVECVASAAMISPGKLPGETHS → VSLCHPGWSAVVQPQLTAVALNPWVKVILLPQPPE
     222-494: Missing.

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,499
Checksum:i4A2EFB9154A4A8B0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QZP2M0QZP2_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PP20A0A1W2PP20_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
435Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCM2C9JCM2_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZC3M0QZC3_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERA9K7ERA9_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGV0A0A0C4DGV0_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
307Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1Y0M0R1Y0_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPB0K7EPB0_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL26786 differs from that shown. Probable cloning artifact.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059914238Q → P. Corresponds to variant dbSNP:rs2249769Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027861187 – 221RMVAG…GETHS → VSLCHPGWSAVVQPQLTAVA LNPWVKVILLPQPPE in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_027862222 – 494Missing in isoform 2. 1 PublicationAdd BLAST273

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY234408 mRNA Translation: AAO89074.1
AK131291 mRNA Translation: BAD18462.1
AK303447 mRNA Translation: BAG64492.1
CH471088 Genomic DNA Translation: EAX01344.1
AF303374 mRNA Translation: AAL26786.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42427.1 [Q86W11-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001106205.1, NM_001112734.3 [Q86W11-1]
NP_001159484.1, NM_001166012.2 [Q86W11-1]
NP_001275640.1, NM_001288711.1
XP_005258240.1, XM_005258183.4 [Q86W11-1]
XP_006722434.1, XM_006722371.3 [Q86W11-1]
XP_011524091.1, XM_011525789.2
XP_016881004.1, XM_017025515.1 [Q86W11-1]
XP_016881008.1, XM_017025519.1
XP_016881009.1, XM_017025520.1
XP_016881010.1, XM_017025521.1
XP_016881011.1, XM_017025522.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000333206; ENSP00000329738; ENSG00000186814 [Q86W11-1]
ENST00000420878; ENSP00000392371; ENSG00000186814 [Q86W11-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100101467

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100101467

UCSC genome browser

More...
UCSCi
uc002kyl.5 human [Q86W11-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY234408 mRNA Translation: AAO89074.1
AK131291 mRNA Translation: BAD18462.1
AK303447 mRNA Translation: BAG64492.1
CH471088 Genomic DNA Translation: EAX01344.1
AF303374 mRNA Translation: AAL26786.1 Sequence problems.
CCDSiCCDS42427.1 [Q86W11-1]
RefSeqiNP_001106205.1, NM_001112734.3 [Q86W11-1]
NP_001159484.1, NM_001166012.2 [Q86W11-1]
NP_001275640.1, NM_001288711.1
XP_005258240.1, XM_005258183.4 [Q86W11-1]
XP_006722434.1, XM_006722371.3 [Q86W11-1]
XP_011524091.1, XM_011525789.2
XP_016881004.1, XM_017025515.1 [Q86W11-1]
XP_016881008.1, XM_017025519.1
XP_016881009.1, XM_017025520.1
XP_016881010.1, XM_017025521.1
XP_016881011.1, XM_017025522.1

3D structure databases

SMRiQ86W11
ModBaseiSearch...

Protein-protein interaction databases

BioGridi755850, 7 interactors
IntActiQ86W11, 12 interactors
MINTiQ86W11
STRINGi9606.ENSP00000392371

PTM databases

iPTMnetiQ86W11
PhosphoSitePlusiQ86W11

Polymorphism and mutation databases

BioMutaiZSCAN30
DMDMi74759452

Proteomic databases

EPDiQ86W11
jPOSTiQ86W11
MassIVEiQ86W11
MaxQBiQ86W11
PaxDbiQ86W11
PeptideAtlasiQ86W11
PRIDEiQ86W11
ProteomicsDBi70101 [Q86W11-1]
70102 [Q86W11-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q86W11

Genome annotation databases

EnsembliENST00000333206; ENSP00000329738; ENSG00000186814 [Q86W11-1]
ENST00000420878; ENSP00000392371; ENSG00000186814 [Q86W11-1]
GeneIDi100101467
KEGGihsa:100101467
UCSCiuc002kyl.5 human [Q86W11-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100101467

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZSCAN30
HGNCiHGNC:33517 ZSCAN30
HPAiHPA007289
neXtProtiNX_Q86W11
OpenTargetsiENSG00000186814
PharmGKBiPA165429212

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000162162
InParanoidiQ86W11
KOiK09230
OMAiGMIWKEM
OrthoDBi1318335at2759
PhylomeDBiQ86W11
TreeFamiTF338304

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZSCAN30 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
100101467
PharosiQ86W11

Protein Ontology

More...
PROi
PR:Q86W11

Gene expression databases

BgeeiENSG00000186814 Expressed in 196 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ86W11 baseline and differential
GenevisibleiQ86W11 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF57667 SSF57667, 4 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 7 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZSC30_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86W11
Secondary accession number(s): B4E0N0, Q6ZNB3, Q96PN3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: June 1, 2003
Last modified: October 16, 2019
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again