Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and SCAN domain-containing protein 30

Gene

ZSCAN30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri301 – 323C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri329 – 351C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri357 – 379C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri385 – 407C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri413 – 435C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri469 – 491C2H2-type 7PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 30
Alternative name(s):
ZNF-WYM
Zinc finger protein 397 opposite strand
Zinc finger protein 397OS
Gene namesi
Name:ZSCAN30
Synonyms:ZNF397OS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000186814.12
HGNCiHGNC:33517 ZSCAN30
neXtProtiNX_Q86W11

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186814
PharmGKBiPA165429212

Polymorphism and mutation databases

BioMutaiZSCAN30
DMDMi74759452

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003006941 – 494Zinc finger and SCAN domain-containing protein 30Add BLAST494

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki197Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ86W11
PaxDbiQ86W11
PeptideAtlasiQ86W11
PRIDEiQ86W11
ProteomicsDBi70101
70102 [Q86W11-3]

PTM databases

iPTMnetiQ86W11
PhosphoSitePlusiQ86W11

Expressioni

Gene expression databases

BgeeiENSG00000186814 Expressed in 196 organ(s), highest expression level in corpus callosum
CleanExiHS_ZNF397OS
ExpressionAtlasiQ86W11 baseline and differential
GenevisibleiQ86W11 HS

Organism-specific databases

HPAiHPA007289

Interactioni

Protein-protein interaction databases

BioGridi755850, 7 interactors
IntActiQ86W11, 5 interactors
MINTiQ86W11
STRINGi9606.ENSP00000329738

Structurei

3D structure databases

ProteinModelPortaliQ86W11
SMRiQ86W11
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 130SCAN boxPROSITE-ProRule annotationAdd BLAST83

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri301 – 323C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri329 – 351C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri357 – 379C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri385 – 407C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri413 – 435C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri469 – 491C2H2-type 7PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000118881
HOVERGENiHBG018163
InParanoidiQ86W11
KOiK09230
OMAiGYECIEC
OrthoDBiEOG091G02KC
PhylomeDBiQ86W11
TreeFamiTF338304

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF57667 SSF57667, 4 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 7 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86W11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGEATVLAY HAPEEQEGLL VVKVEEENYV LDQDFGLQEN PWSQEVFRQK
60 70 80 90 100
FRQFSYSDST GPREALSRLR ELCCQWLRPE VHSKEQILEL LMLEQFLAIL
110 120 130 140 150
PEELQAWLRE HRPENGEEAV TMLEELEKEL EEPRQQDTTH GQEMFWQEMT
160 170 180 190 200
STGALKSLSL NSPVQPLENQ CKTETQESQA FQERDGRMVA GKVLMAKQEI
210 220 230 240 250
VECVASAAMI SPGKLPGETH SQRIAEEALG GLDNSKKQKG NAAGNKISQL
260 270 280 290 300
PSQDRHFSLA TFNRRIPTEH SVLESHESEG SFSMNSNDIT QQSVDTREKL
310 320 330 340 350
YECFDCGKAF CQSSKLIRHQ RIHTGERPYA CKECGKAFSL SSDLVRHQRI
360 370 380 390 400
HSGEKPYECC ECGKAFRGSS ELIRHRRIHT GEKPYECGEC GKAFSRSSAL
410 420 430 440 450
IQHKKIHTGD KSYECIACGK AFGRSSILIE HQRIHTGEKP YECNECGKSF
460 470 480 490
NQSSALTQHQ RIHTGEKPYE CSECRKTFRH RSGLMQHQRT HTRV
Length:494
Mass (Da):56,364
Last modified:June 1, 2003 - v1
Checksum:i04D07EE957654505
GO
Isoform 2 (identifier: Q86W11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-221: RMVAGKVLMAKQEIVECVASAAMISPGKLPGETHS → VSLCHPGWSAVVQPQLTAVALNPWVKVILLPQPPE
     222-494: Missing.

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,499
Checksum:i4A2EFB9154A4A8B0
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2PP20A0A1W2PP20_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
435Annotation score:
C9JCM2C9JCM2_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
221Annotation score:
M0QZC3M0QZC3_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
145Annotation score:
M0QZP2M0QZP2_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
91Annotation score:
K7ERA9K7ERA9_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
69Annotation score:
A0A0C4DGV0A0A0C4DGV0_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
307Annotation score:
M0R1Y0M0R1Y0_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
51Annotation score:
K7EPB0K7EPB0_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN30
47Annotation score:

Sequence cautioni

The sequence AAL26786 differs from that shown. Probable cloning artifact.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059914238Q → P. Corresponds to variant dbSNP:rs2249769Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027861187 – 221RMVAG…GETHS → VSLCHPGWSAVVQPQLTAVA LNPWVKVILLPQPPE in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_027862222 – 494Missing in isoform 2. 1 PublicationAdd BLAST273

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY234408 mRNA Translation: AAO89074.1
AK131291 mRNA Translation: BAD18462.1
AK303447 mRNA Translation: BAG64492.1
CH471088 Genomic DNA Translation: EAX01344.1
AF303374 mRNA Translation: AAL26786.1 Sequence problems.
CCDSiCCDS42427.1 [Q86W11-1]
RefSeqiNP_001106205.1, NM_001112734.3 [Q86W11-1]
NP_001159484.1, NM_001166012.2 [Q86W11-1]
NP_001275640.1, NM_001288711.1
XP_005258240.1, XM_005258183.4 [Q86W11-1]
XP_006722434.1, XM_006722371.3 [Q86W11-1]
XP_011524091.1, XM_011525789.2
XP_016881004.1, XM_017025515.1 [Q86W11-1]
XP_016881008.1, XM_017025519.1
XP_016881009.1, XM_017025520.1
XP_016881010.1, XM_017025521.1
XP_016881011.1, XM_017025522.1
UniGeneiHs.619840

Genome annotation databases

EnsembliENST00000333206; ENSP00000329738; ENSG00000186814 [Q86W11-1]
ENST00000420878; ENSP00000392371; ENSG00000186814 [Q86W11-1]
GeneIDi100101467
KEGGihsa:100101467
UCSCiuc002kyl.5 human [Q86W11-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY234408 mRNA Translation: AAO89074.1
AK131291 mRNA Translation: BAD18462.1
AK303447 mRNA Translation: BAG64492.1
CH471088 Genomic DNA Translation: EAX01344.1
AF303374 mRNA Translation: AAL26786.1 Sequence problems.
CCDSiCCDS42427.1 [Q86W11-1]
RefSeqiNP_001106205.1, NM_001112734.3 [Q86W11-1]
NP_001159484.1, NM_001166012.2 [Q86W11-1]
NP_001275640.1, NM_001288711.1
XP_005258240.1, XM_005258183.4 [Q86W11-1]
XP_006722434.1, XM_006722371.3 [Q86W11-1]
XP_011524091.1, XM_011525789.2
XP_016881004.1, XM_017025515.1 [Q86W11-1]
XP_016881008.1, XM_017025519.1
XP_016881009.1, XM_017025520.1
XP_016881010.1, XM_017025521.1
XP_016881011.1, XM_017025522.1
UniGeneiHs.619840

3D structure databases

ProteinModelPortaliQ86W11
SMRiQ86W11
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi755850, 7 interactors
IntActiQ86W11, 5 interactors
MINTiQ86W11
STRINGi9606.ENSP00000329738

PTM databases

iPTMnetiQ86W11
PhosphoSitePlusiQ86W11

Polymorphism and mutation databases

BioMutaiZSCAN30
DMDMi74759452

Proteomic databases

MaxQBiQ86W11
PaxDbiQ86W11
PeptideAtlasiQ86W11
PRIDEiQ86W11
ProteomicsDBi70101
70102 [Q86W11-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333206; ENSP00000329738; ENSG00000186814 [Q86W11-1]
ENST00000420878; ENSP00000392371; ENSG00000186814 [Q86W11-1]
GeneIDi100101467
KEGGihsa:100101467
UCSCiuc002kyl.5 human [Q86W11-1]

Organism-specific databases

CTDi100101467
EuPathDBiHostDB:ENSG00000186814.12
GeneCardsiZSCAN30
HGNCiHGNC:33517 ZSCAN30
HPAiHPA007289
neXtProtiNX_Q86W11
OpenTargetsiENSG00000186814
PharmGKBiPA165429212
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000118881
HOVERGENiHBG018163
InParanoidiQ86W11
KOiK09230
OMAiGYECIEC
OrthoDBiEOG091G02KC
PhylomeDBiQ86W11
TreeFamiTF338304

Miscellaneous databases

ChiTaRSiZSCAN30 human
GenomeRNAii100101467
PROiPR:Q86W11

Gene expression databases

BgeeiENSG00000186814 Expressed in 196 organ(s), highest expression level in corpus callosum
CleanExiHS_ZNF397OS
ExpressionAtlasiQ86W11 baseline and differential
GenevisibleiQ86W11 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF57667 SSF57667, 4 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 7 hits
PS50157 ZINC_FINGER_C2H2_2, 7 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZSC30_HUMAN
AccessioniPrimary (citable) accession number: Q86W11
Secondary accession number(s): B4E0N0, Q6ZNB3, Q96PN3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: June 1, 2003
Last modified: November 7, 2018
This is version 138 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again