Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (16 Jan 2019)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho guanine nucleotide exchange factor 25

Gene

ARHGEF25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in actin cytoskeleton reorganization in different tissues since its activation induces formation of actin stress fibers. It works as a guanine nucleotide exchange factor for Rho family of small GTPases. Links specifically G alpha q/11-coupled receptors to RHOA activation. May be an important regulator of processes involved in axon and dendrite formation. In neurons seems to be an exchange factor primarily for RAC1. Involved in skeletal myogenesis (By similarity).By similarity6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-416476 G alpha (q) signalling events

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q86VW2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 25
Alternative name(s):
Guanine nucleotide exchange factor GEFT
Rac/Cdc42/Rho exchange factor GEFT
RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT
p63RhoGEF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGEF25
Synonyms:GEFT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000240771.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30275 ARHGEF25

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610215 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86VW2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi301L → E: Abolishes its exchange activity on RHOA. 1 Publication1
Mutagenesisi471F → A: Reduces exchange activity mediated by GNAQ activation; in truncated construct. 1 Publication1
Mutagenesisi472L → A: Reduces exchange activity mediated by GNAQ activation; in truncated construct. 1 Publication1
Mutagenesisi475L → A: Reduces exchange activity mediated by GNAQ activation; in truncated construct. 1 Publication1
Mutagenesisi478P → A: Reduces exchange activity mediated by GNAQ activation; in truncated construct. 1 Publication1
Mutagenesisi479I → A: Reduces exchange activity mediated by GNAQ activation; in truncated construct. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
115557

Open Targets

More...
OpenTargetsi
ENSG00000240771

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGEF25

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172046695

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003221321 – 580Rho guanine nucleotide exchange factor 25Add BLAST580

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86VW2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86VW2

PeptideAtlas

More...
PeptideAtlasi
Q86VW2

PRoteomics IDEntifications database

More...
PRIDEi
Q86VW2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70082
70083 [Q86VW2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86VW2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86VW2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q86VW2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are highly expressed in excitable tissues, such as brain, heart and muscle. Also detected in kidney and liver.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000240771 Expressed in 179 organ(s), highest expression level in esophagus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86VW2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86VW2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052016

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via the DH domain) with BVES (via the C-terminus cytoplasmic tail) (By similarity). Interacts with activated GNAQ and GNA11. Interacts with RHOA, CDC42 and RAC1.By similarity4 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125438, 9 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q86VW2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000335560

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1580
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2RGNX-ray3.50B/E149-502[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q86VW2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86VW2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q86VW2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini160 – 336DHPROSITE-ProRule annotationAdd BLAST177
Domaini348 – 466PHPROSITE-ProRule annotationAdd BLAST119

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni278 – 299Important for binding to Rho GTPasesAdd BLAST22
Regioni467 – 493Sufficient to bind activated GNAQAdd BLAST27

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The guanine nucleotide exchange activity is autoinhibited by the PH domain.1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQSV Eukaryota
ENOG410ZKYJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160422

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112709

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG065330

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86VW2

KEGG Orthology (KO)

More...
KOi
K20690

Identification of Orthologs from Complete Genome Data

More...
OMAi
SQILETQ

Database of Orthologous Groups

More...
OrthoDBi
301115at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86VW2

TreeFam database of animal gene trees

More...
TreeFami
TF318080

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00160 RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030738 ARHGEF25
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR011993 PH-like_dom_sf
IPR001849 PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR22826:SF195 PTHR22826:SF195, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00621 RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00325 RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065 SSF48065, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q86VW2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRGGHKGGRC ACPRVIRKVL AKCGCCFARG GRESYSIAGS EGSISASAAS
60 70 80 90 100
GLAAPSGPSS GLSSGPCSPG PPGPVSGLRR WLDHSKHCLS VETEADSGQA
110 120 130 140 150
GPYENWMLEP ALATGEELPE LTLLTTLLEG PGDKTQPPEE ETLSQAPESE
160 170 180 190 200
EEQKKKALER SMYVLSELVE TEKMYVDDLG QIVEGYMATM AAQGVPESLR
210 220 230 240 250
GRDRIVFGNI QQIYEWHRDY FLQELQRCLK DPDWLAQLFI KHERRLHMYV
260 270 280 290 300
VYCQNKPKSE HVVSEFGDSY FEELRQQLGH RLQLNDLLIK PVQRIMKYQL
310 320 330 340 350
LLKDFLKYYN RAGMDTADLE QAVEVMCFVP KRCNDMMTLG RLRGFEGKLT
360 370 380 390 400
AQGKLLGQDT FWVTEPEAGG LLSSRGRERR VFLFEQIIIF SEALGGGVRG
410 420 430 440 450
GTQPGYVYKN SIKVSCLGLE GNLQGDPCRF ALTSRGPEGG IQRYVLQAAD
460 470 480 490 500
PAISQAWIKH VAQILESQRD FLNALQSPIE YQRRESQTNS LGRPRGPGVG
510 520 530 540 550
SPGRIQLGDQ AQGSTHTPIN GSLPSLLLSP KGEVARALLP LDKQALGDIP
560 570 580
QAPHDSPPVS PTPKTPPCQA RLAKLDEDEL
Length:580
Mass (Da):63,843
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3EC80445D965BFB
GO
Isoform 2 (identifier: Q86VW2-2) [UniParc]FASTAAdd to basket
Also known as: p63RhoGef

The sequence of this isoform differs from the canonical sequence as follows:
     1-106: Missing.

Show »
Length:474
Mass (Da):53,173
Checksum:i627A0D3DCEC92F99
GO
Isoform 3 (identifier: Q86VW2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MRGGHKGGRCACPRVIRKVLAKCGCCFARGGR → MKPPDRPAPG...HEVLAGALQP

Show »
Length:619
Mass (Da):68,114
Checksum:iDF18CD3D7D3B1AFD
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_039402253C → Y2 PublicationsCorresponds to variant dbSNP:rs17857333Ensembl.1
Natural variantiVAR_039403397G → R1 PublicationCorresponds to variant dbSNP:rs17854492Ensembl.1
Natural variantiVAR_039404506Q → R2 PublicationsCorresponds to variant dbSNP:rs1564374Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0318751 – 106Missing in isoform 2. 1 PublicationAdd BLAST106
Alternative sequenceiVSP_0472541 – 32MRGGH…ARGGR → MKPPDRPAPGRTDRILGVMG GMLRACALPGQEGPPRRSPL GLVGTEPESERTEGDHRRDR EHEVLAGALQP in isoform 3. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF487514 mRNA Translation: AAO49463.2
AB370196 mRNA Translation: BAF94999.1
AC025165 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97037.1
BC012860 mRNA Translation: AAH12860.1
BC018536 mRNA Translation: AAH18536.1
BC047559 mRNA Translation: AAH47559.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44931.1 [Q86VW2-3]
CCDS8947.1 [Q86VW2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001104740.1, NM_001111270.2
NP_001334862.1, NM_001347933.1
NP_891992.2, NM_182947.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.61581

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000286494; ENSP00000286494; ENSG00000240771 [Q86VW2-1]
ENST00000333972; ENSP00000335560; ENSG00000240771 [Q86VW2-3]
ENST00000616622; ENSP00000484303; ENSG00000240771 [Q86VW2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
115557

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:115557

UCSC genome browser

More...
UCSCi
uc001spa.5 human [Q86VW2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF487514 mRNA Translation: AAO49463.2
AB370196 mRNA Translation: BAF94999.1
AC025165 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97037.1
BC012860 mRNA Translation: AAH12860.1
BC018536 mRNA Translation: AAH18536.1
BC047559 mRNA Translation: AAH47559.1
CCDSiCCDS44931.1 [Q86VW2-3]
CCDS8947.1 [Q86VW2-1]
RefSeqiNP_001104740.1, NM_001111270.2
NP_001334862.1, NM_001347933.1
NP_891992.2, NM_182947.3
UniGeneiHs.61581

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2RGNX-ray3.50B/E149-502[»]
ProteinModelPortaliQ86VW2
SMRiQ86VW2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125438, 9 interactors
CORUMiQ86VW2
STRINGi9606.ENSP00000335560

PTM databases

iPTMnetiQ86VW2
PhosphoSitePlusiQ86VW2
SwissPalmiQ86VW2

Polymorphism and mutation databases

BioMutaiARHGEF25
DMDMi172046695

Proteomic databases

jPOSTiQ86VW2
PaxDbiQ86VW2
PeptideAtlasiQ86VW2
PRIDEiQ86VW2
ProteomicsDBi70082
70083 [Q86VW2-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000286494; ENSP00000286494; ENSG00000240771 [Q86VW2-1]
ENST00000333972; ENSP00000335560; ENSG00000240771 [Q86VW2-3]
ENST00000616622; ENSP00000484303; ENSG00000240771 [Q86VW2-2]
GeneIDi115557
KEGGihsa:115557
UCSCiuc001spa.5 human [Q86VW2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
115557
DisGeNETi115557
EuPathDBiHostDB:ENSG00000240771.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGEF25
HGNCiHGNC:30275 ARHGEF25
HPAiHPA052016
MIMi610215 gene
neXtProtiNX_Q86VW2
OpenTargetsiENSG00000240771

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IQSV Eukaryota
ENOG410ZKYJ LUCA
GeneTreeiENSGT00940000160422
HOGENOMiHOG000112709
HOVERGENiHBG065330
InParanoidiQ86VW2
KOiK20690
OMAiSQILETQ
OrthoDBi301115at2759
PhylomeDBiQ86VW2
TreeFamiTF318080

Enzyme and pathway databases

ReactomeiR-HSA-416476 G alpha (q) signalling events
SIGNORiQ86VW2

Miscellaneous databases

EvolutionaryTraceiQ86VW2

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GEFT

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
115557

Protein Ontology

More...
PROi
PR:Q86VW2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000240771 Expressed in 179 organ(s), highest expression level in esophagus
ExpressionAtlasiQ86VW2 baseline and differential
GenevisibleiQ86VW2 HS

Family and domain databases

CDDicd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR030738 ARHGEF25
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR22826:SF195 PTHR22826:SF195, 1 hit
PfamiView protein in Pfam
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARHGP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86VW2
Secondary accession number(s): A6NJH5
, A9CQZ6, F8W7Z4, Q8WV84, Q96E63
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: January 16, 2019
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again