Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (02 Jun 2021)
Sequence version 2 (02 Sep 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Immunoglobulin-like and fibronectin type III domain-containing protein 1

Gene

IGFN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86VF2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Immunoglobulin-like and fibronectin type III domain-containing protein 1
Alternative name(s):
EEF1A2-binding protein 1
KY-interacting protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IGFN1
Synonyms:EEF1A2BP1, KYIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24607, IGFN1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86VF2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000163395.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
91156

Open Targets

More...
OpenTargetsi
ENSG00000163395

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86VF2, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IGFN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
205785468

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003471861 – 1251Immunoglobulin-like and fibronectin type III domain-containing protein 1Add BLAST1251

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86VF2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86VF2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86VF2

PeptideAtlas

More...
PeptideAtlasi
Q86VF2

PRoteomics IDEntifications database

More...
PRIDEi
Q86VF2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
30502
69997 [Q86VF2-1]
69998 [Q86VF2-2]
69999 [Q86VF2-3]
70000 [Q86VF2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86VF2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86VF2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163395, Expressed in gastrocnemius and 129 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86VF2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000163395, Tissue enriched (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FLNC (By similarity).

Interacts with KY.

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
Q86VF2
With#Exp.IntAct
MEOX2 [P50222]3EBI-10259767,EBI-748397
Isoform 5 [Q86VF2-5]
With#Exp.IntAct
BANP - isoform 2 [Q8N9N5-2]3EBI-11955401,EBI-11524452
BLZF1 [Q9H2G9]3EBI-11955401,EBI-2548012
C19orf54 - isoform 3 [Q5BKX5-3]3EBI-11955401,EBI-11976299
COG6 [Q9Y2V7]3EBI-11955401,EBI-3866319
CRX [O43186]3EBI-11955401,EBI-748171
DDAH2 [O95865]3EBI-11955401,EBI-749139
FXR2 [P51116]3EBI-11955401,EBI-740459
GOLGA2 [Q08379]3EBI-11955401,EBI-618309
HOXA1 [P49639]3EBI-11955401,EBI-740785
HOXD3 [P31249]3EBI-11955401,EBI-3957655
KCTD9 [Q7L273]3EBI-11955401,EBI-4397613
KIFC3 - isoform 4 [Q9BVG8-5]3EBI-11955401,EBI-14069005
KRT39 [Q6A163]3EBI-11955401,EBI-11958242
KRTAP6-2 [Q3LI66]3EBI-11955401,EBI-11962084
LHX9 [Q9NQ69]3EBI-11955401,EBI-10175218
LZTS2 [Q9BRK4]3EBI-11955401,EBI-741037
MEOX2 [Q6FHY5]3EBI-11955401,EBI-16439278
MID2 - isoform 2 [Q9UJV3-2]3EBI-11955401,EBI-10172526
MYOD1 [P15172]3EBI-11955401,EBI-488878
NHLRC4 [P0CG21]3EBI-11955401,EBI-12868744
PIBF1 [Q4G0R1]3EBI-11955401,EBI-14066006
PNMA1 [Q8ND90]3EBI-11955401,EBI-302345
POF1B - isoform 1 [Q8WVV4-1]3EBI-11955401,EBI-11986735
POU6F2 [P78424]3EBI-11955401,EBI-12029004
PRKAR1B [P31321]3EBI-11955401,EBI-2805516
PRR23B [Q6ZRT6]3EBI-11955401,EBI-12845180
SERTAD2 [Q14140]3EBI-11955401,EBI-2822051
SPAG5 [Q96R06]3EBI-11955401,EBI-413317
TAX1BP1 [Q86VP1]3EBI-11955401,EBI-529518
TRIM21 [P19474]3EBI-11955401,EBI-81290
TRIM27 [P14373]3EBI-11955401,EBI-719493
TRIM35 - isoform 2 [Q9UPQ4-2]3EBI-11955401,EBI-17716262
TRIM42 [Q8IWZ5]3EBI-11955401,EBI-5235829
TRIP13 [Q15645]3EBI-11955401,EBI-358993
TSC1 [Q86WV8]3EBI-11955401,EBI-12806590
UBAP2 [Q5T6F2]3EBI-11955401,EBI-2514383
USP54 - isoform 6 [Q70EL1-9]3EBI-11955401,EBI-11975223
ZNF620 [Q6ZNG0]3EBI-11955401,EBI-4395669
ZNF688 [P0C7X2]3EBI-11955401,EBI-4395732

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124802, 40 interactors

Protein interaction database and analysis system

More...
IntActi
Q86VF2, 41 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000334714

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86VF2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86VF2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini29 – 119Ig-like 1Add BLAST91
Domaini309 – 398Ig-like 2Add BLAST90
Domaini454 – 539Ig-like 3Add BLAST86
Domaini646 – 741Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST96
Domaini746 – 845Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST100
Domaini847 – 942Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini946 – 1030Ig-like 4Add BLAST85
Domaini1043 – 1137Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST95
Domaini1151 – 1245Ig-like 5Add BLAST95

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni61 – 81DisorderedSequence analysisAdd BLAST21
Regioni403 – 454DisorderedSequence analysisAdd BLAST52

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili188 – 221Sequence analysisAdd BLAST34

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi65 – 81Polar residuesSequence analysisAdd BLAST17
Compositional biasi403 – 436Basic and acidic residuesSequence analysisAdd BLAST34

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0613, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162073

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006405_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86VF2

Identification of Orthologs from Complete Genome Data

More...
OMAi
LGAPKGM

Database of Orthologous Groups

More...
OrthoDBi
103399at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86VF2

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063, FN3, 4 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 11 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR040849, MyBP-C_THB

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041, fn3, 4 hits
PF07679, I-set, 5 hits
PF18362, THB, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060, FN3, 4 hits
SM00409, IG, 7 hits
SM00408, IGc2, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 7 hits
SSF49265, SSF49265, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853, FN3, 4 hits
PS50835, IG_LIKE, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q86VF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGKLRKSHI PGVSIWQLVE EIPEGCSTPD FEQKPVTSAL PEGKNAVFRA
60 70 80 90 100
VVCGEPRPEV RWQNSKGDLS DSSKYKISSS PGSKEHVLQI NKLTGEDTDL
110 120 130 140 150
YRCTAVNAYG EAACSVRLTV IEVGFRKNRK RHREPQEDLR KELMDFRKLL
160 170 180 190 200
KKRAPPAPKK KMDLEQIWQL LMTADRKDYE KICLKYGIVD YRGMLRRLQE
210 220 230 240 250
MKKEQEDKMA QYINTISSLR HIRVTKDGNA KFDLELDLKD SQSKIYLYKD
260 270 280 290 300
GEMIPYGFNN QTKHCLRRLG KRYEFQIQDL RPEDSGIYQV KVEDAVVFST
310 320 330 340 350
ELEASAIPPR VVVPLAETHC EEQGDAVFEC TLSSPCPSAA WHFRHRLLHP
360 370 380 390 400
SDKYEVYVSP DGLTHRLVVR GARFSDMGPY SLGTGLYTSS AWLVVEAGKD
410 420 430 440 450
KDLQSTSADH KLQSRRSGKD GRLDIYGERR DATRSSTSRY KPGTGSFSKD
460 470 480 490 500
AQGPMGHFSQ GLADMEVQPG EAATLSCTLT SDLGPGTWFK DGVKLTTQDG
510 520 530 540 550
VIFKQDGLVH SLFITHVQGT QAGRYTFVAG DQQSEATLTV QDSPTIAPDV
560 570 580 590 600
TEKLREPLVV KAGKPVIVKI PFQSHLPIQA AWRKDGAEVV GSSDREAQVD
610 620 630 640 650
LGDGYTRLCL PSAGRKDCGQ YSVTLRSEGG SVQAELTLQV IDKPDPPQGP
660 670 680 690 700
MEVQDCHRAG VCLRWRPPRD NGGRTVECYV VERRQAGRST WLKVGEAPAD
710 720 730 740 750
STTFTDAHVE PGRKYTFRVR AVTSEGAGEA LESEEILVAP EALPKAPSAP
760 770 780 790 800
AILSASSQGI TLTWTAPRGP GSAHILGYLI ERRKKGSNTW TAVNDQPVPE
810 820 830 840 850
RRWTVADVRQ GCQYEFRVTA VAPSGPGEPG PPSDAVFARD PMRPPGLVRN
860 870 880 890 900
LQVTDRSNTS ITLSWAGPDT QEGDEAQGYV VELCSSDSLQ WLPCHVGTVP
910 920 930 940 950
VTTYTAKGLR PGEGYFVRVT AVNEGGQSQP SALDTLVQAM PVTVCPKFLV
960 970 980 990 1000
DSSTKDLLTV KVGDTVRVPV SFEAMPMPEV TWLKDGLPLP KRSVTVTKDG
1010 1020 1030 1040 1050
LTQLLIPVAG LSDSGLYTVV LRTLQGKEVA HSFRIRVAAC PQAPGPIHLQ
1060 1070 1080 1090 1100
ENVPGTVTAE WEPSPDEAQD VPLHYAVFTR SSAHGPWHEA ADRIHTNRFT
1110 1120 1130 1140 1150
LLGILPGHEY HFRVVAKNEL GASKPSDTSQ PWCIPRQRDR FTVKAPCYRE
1160 1170 1180 1190 1200
PDLSQKPRFL VGLRSHLLPQ GCECCMSCAV QGSPRPHVTW FKNDRSLEGN
1210 1220 1230 1240 1250
PAVYSTDLLG VCSLTIPSVS PKDSGEYKAV AENTLGQAVS TATLIVIEPS

T
Length:1,251
Mass (Da):137,763
Last modified:September 2, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1730143C58C58DAF
GO
Isoform 2 (identifier: Q86VF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-383: Missing.
     384-413: TGLYTSSAWLVVEAGKDKDLQSTSADHKLQ → MGWQPMGENWGCLEEMLNEDQSREPPGHLG

Show »
Length:868
Mass (Da):94,050
Checksum:iBB8DB9DC20C96C8C
GO
Isoform 3 (identifier: Q86VF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-383: Missing.
     384-413: TGLYTSSAWLVVEAGKDKDLQSTSADHKLQ → MGWQPMGENWGCLEEMLNEDQSREPPGHLG
     974-988: AMPMPEVTWLKDGLP → HARRPLGPSTCRRTC
     989-1251: Missing.

Show »
Length:605
Mass (Da):65,359
Checksum:iA89D34F853AAA7DC
GO
Isoform 4 (identifier: Q86VF2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     566-570: VIVKI → IQTYH
     571-1251: Missing.

Show »
Length:570
Mass (Da):64,070
Checksum:i29437D5DEA9DBD08
GO
Isoform 5 (identifier: Q86VF2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-413: Q → QRQGAQASGA...QSREPPGHLG

Show »
Length:3,708
Mass (Da):383,805
Checksum:i8E8A7AB25FB2C2F7
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0460351056T → M. Corresponds to variant dbSNP:rs6690992Ensembl.1
Natural variantiVAR_0460361095H → Y3 PublicationsCorresponds to variant dbSNP:rs3738270Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0350551 – 383Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST383
Alternative sequenceiVSP_035056384 – 413TGLYT…DHKLQ → MGWQPMGENWGCLEEMLNED QSREPPGHLG in isoform 2 and isoform 3. 3 PublicationsAdd BLAST30
Alternative sequenceiVSP_045740413Q → QRQGAQASGAEESGSIESQG EKSREQGPRGGSLEGAGPAS GLQHIASPDRDGLGRHGYSL MGDKGTADSAWGPGQEGEGF PVAEGSRATLPRENQSHREG GWARSLAERPHLQGESSESG LGLPEKQQQDRGRDSNSDEC WRKAGGWEAGSSRLQAGGLG SSREGKEHRGDSGRQLDRHA PEQLWDARLGPGRGKSDLQG CQSDPVGSWPRGKQIEISQD DSLAEMDRGDAPSRERGRGI VVWGGGTGLGEAGDSNGAGG PGTLELTGGRGSGSKVGMAP ESWGSQGGRDADYGEARGYW GSGELLEQIPGGKDFQEPSI SGGRKFLLGDGSPEIKAEDS LQEADGICRGESVVTGSAYK TGPGGPGDPRGCEGVLQELR GRDGQETAWASGEVEYDPRS FQSSQGWTAGHRAAGGIGRI ESKGTSPWDDTPSSLRKTGA HHGPGVLGPSGGQEGMGGIW VAGLTESGQGVDARSHWLSR APGLGAQGSGGTLGDKKGLR GPGSIGSEPDFWNGSGSSRV KGPRGETGYKDGLEGPGRME SRYEGGLGYSREISSKSGAG YSYGSGVPGEMGSGHGAGCR VSPRAPAGVESEEGGGYRHG SGAPGGVWSGNEDSGPAGGG SGRVASLKNGSGGPDGAPMN DTRNWASACQAGMDPRGGHH SDGGLGSPGVTGSAGRGGLK APGVVETVGMGCVEAEPESS GRIRPWGQTGNYGGFRASEA LGAFGEGGYEDGSGGPGAMG PGSLRAGSKVGEGDGTRCPG AKASGAGAGYRDDTRHPESL APHNGAASGSQWAYGAGNVL GYEDGSELPGPQGTGVRTAY GERSRGLGPRSTGPGGEAGF RDGSGGLQGMGSADGPGCRK GIGSSGEMGSVDKEGYKKDL GAPENMGSGSKADYRDGVGG SGAMGSMDEAGYRKDLGAPE GISSGSKADYRGGLQDSREA GSGSKADYSGGLKGSREIGS MDETDNRKDLGVPEGMGAGY RAGLRGPGEMGSLDESGHRN GIGGYGEMGSGYREDLGAPE GMGTGSKAGYRDGLRGSGEM RSMDEAGYRKNLGAPERMDS GSKAGYRGGLRGSGEMGLIE AGYRKDLGVSEGGGSGSKAG YRGGLGSGEMGSVDKAGYRK DLGASEAIGSGSKAGFTDGL GGSEEMGSVNKAGYRKDLGA PKGMGSGSKASFRDGLGGSG EMGSVNEAGYRKDLGVPEGI GSGSKAGFRDGLGGSEEMGS VNKAGYRKDLGAPKGIGSGS KAGFRDGLGSSGEMGSMDEA GYRKNLGAPEGIGSGSKAGF RDGLGSSVEMGSVNEAGYRK DLGAPEGMGSGSKAGFRDGL GGSGEMGSVNEAGYRKDLGA PKGIGSGSKADFRDALGSSG EMGSMDEAGYRKDLWAPEGI GSGSKAGFRDGLGSSVEMGS VNEAGYRKDLGAPEGMGSGS KAGFRDGLGGSGEMGSVNEA GYRKDLGAPKGIGSGSKADF RDALGSSGEMGSMDEAGYRK DLWAPEGIGSGSKAGFRDGL GSSVEMGSVNEAGYRKDLGA PEGMGSGSKEGFRDGLGGSE EMGSVNKAGYRKDLGAPKGM GSGSKEGFRDGLGGSEEMGS MDEAGYRKDLGAPEGIGSGS KAGFRDGLGGSEEMRSMDEA GYRKDLGAPERIGSGSKAGF RDGLGSSVEMGSVNEAGYRK DLGAPKGMGSGSKTGFRDGL GGSEEMESMDEAGYRKDLGA PEGIGSGSKAGFRDGLGSST EMGSVNEAGYRKDLGAPKGM GSESKAGFRDGLGSSGEMGS MDEAGYRKDLGAPEGMGSGS KAGFRDGLGGSEEMGSVNKA GYRKDLGAPKGMGSGSKAGF RDGLGSSGEMGSMDEADYRK DLGAPEEMGSGSYTDYRNGL GSSGKISSGDEAGYKNVLGG SGRNPLGSEAGSRGSLEDSG YILSWNEAGSRQGFGGTSGM GSGSEVSYRGGSGGSGETGP EGKMGYGDGSGRLGVPGSLA GIGHEAGPRGHKAMGHRSGY WVASEGDTNSKDGPERARET RLVDGAGPGVEPGMAGMPGT AGGMAHRDSLRGTGVLGSQG GRQTLSDERGSTKDLGGYGT SGIPEASEAAGAKGKPDVKE WQDSSGTPGSSRDRGAPRVK DRSPDQAGIMGASGFLDGKG AVEGETWAGMAALGSGYERD IWKAGPGMTDRGRVAGQGGL ASQGGGDSLLGGRRVGSGSS VGTGQDLDSGSMPGGRGKST SGPADRQGTSNAWAPDWENQ GFSQGSIDAGKQPAGSRASG SLQEKDAAFGGTHEGPGGFK GGEGAPGQEAAGGCRSPWSL DSKGSSPGRGSSVDAEDSGI LGKGNSTEWGNALTPKPGES GPQGAWNGLDGPFGRKASRD RSGGTQDLSSQRGKGQRGGK RSLGEQGSLEAENGEVQGPG ALKEDEGQGVEEAGRSGRRP GSLRSRSQAQSGAEVGGGKR RGADEAGSMGWQPMGENWGC LEEMLNEDQSREPPGHLG in isoform 5. Curated1
Alternative sequenceiVSP_035057566 – 570VIVKI → IQTYH in isoform 4. 1 Publication5
Alternative sequenceiVSP_035058571 – 1251Missing in isoform 4. 1 PublicationAdd BLAST681
Alternative sequenceiVSP_035059974 – 988AMPMP…KDGLP → HARRPLGPSTCRRTC in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_035060989 – 1251Missing in isoform 3. 1 PublicationAdd BLAST263

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY245430 mRNA Translation: AAO92932.1
AL137493 Transcribed RNA Translation: CAB70770.2
AC103925 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91347.1
BC033185 mRNA No translation available.
BC131529 mRNA Translation: AAI31530.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53455.1 [Q86VF2-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46475

NCBI Reference Sequences

More...
RefSeqi
NP_001158058.1, NM_001164586.1 [Q86VF2-5]
XP_011508422.1, XM_011510120.2 [Q86VF2-5]
XP_011508423.1, XM_011510121.2 [Q86VF2-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000295591; ENSP00000295591; ENSG00000163395 [Q86VF2-1]
ENST00000335211; ENSP00000334714; ENSG00000163395 [Q86VF2-5]
ENST00000437879; ENSP00000399041; ENSG00000163395 [Q86VF2-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
91156

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:91156

UCSC genome browser

More...
UCSCi
uc001gwc.3, human [Q86VF2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY245430 mRNA Translation: AAO92932.1
AL137493 Transcribed RNA Translation: CAB70770.2
AC103925 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91347.1
BC033185 mRNA No translation available.
BC131529 mRNA Translation: AAI31530.1
CCDSiCCDS53455.1 [Q86VF2-5]
PIRiT46475
RefSeqiNP_001158058.1, NM_001164586.1 [Q86VF2-5]
XP_011508422.1, XM_011510120.2 [Q86VF2-5]
XP_011508423.1, XM_011510121.2 [Q86VF2-5]

3D structure databases

SMRiQ86VF2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124802, 40 interactors
IntActiQ86VF2, 41 interactors
STRINGi9606.ENSP00000334714

PTM databases

iPTMnetiQ86VF2
PhosphoSitePlusiQ86VF2

Genetic variation databases

BioMutaiIGFN1
DMDMi205785468

Proteomic databases

jPOSTiQ86VF2
MassIVEiQ86VF2
PaxDbiQ86VF2
PeptideAtlasiQ86VF2
PRIDEiQ86VF2
ProteomicsDBi30502
69997 [Q86VF2-1]
69998 [Q86VF2-2]
69999 [Q86VF2-3]
70000 [Q86VF2-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34499, 95 antibodies

The DNASU plasmid repository

More...
DNASUi
91156

Genome annotation databases

EnsembliENST00000295591; ENSP00000295591; ENSG00000163395 [Q86VF2-1]
ENST00000335211; ENSP00000334714; ENSG00000163395 [Q86VF2-5]
ENST00000437879; ENSP00000399041; ENSG00000163395 [Q86VF2-4]
GeneIDi91156
KEGGihsa:91156
UCSCiuc001gwc.3, human [Q86VF2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
91156
DisGeNETi91156

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IGFN1
HGNCiHGNC:24607, IGFN1
HPAiENSG00000163395, Tissue enriched (skeletal)
neXtProtiNX_Q86VF2
OpenTargetsiENSG00000163395
VEuPathDBiHostDB:ENSG00000163395.16

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0613, Eukaryota
GeneTreeiENSGT00940000162073
HOGENOMiCLU_006405_2_1_1
InParanoidiQ86VF2
OMAiLGAPKGM
OrthoDBi103399at2759
PhylomeDBiQ86VF2

Enzyme and pathway databases

PathwayCommonsiQ86VF2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
91156, 12 hits in 930 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IGFN1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
91156
PharosiQ86VF2, Tdark

Protein Ontology

More...
PROi
PR:Q86VF2
RNActiQ86VF2, protein

Gene expression databases

BgeeiENSG00000163395, Expressed in gastrocnemius and 129 other tissues
GenevisibleiQ86VF2, HS

Family and domain databases

CDDicd00063, FN3, 4 hits
Gene3Di2.60.40.10, 11 hits
InterProiView protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR040849, MyBP-C_THB
PfamiView protein in Pfam
PF00041, fn3, 4 hits
PF07679, I-set, 5 hits
PF18362, THB, 1 hit
SMARTiView protein in SMART
SM00060, FN3, 4 hits
SM00409, IG, 7 hits
SM00408, IGc2, 4 hits
SUPFAMiSSF48726, SSF48726, 7 hits
SSF49265, SSF49265, 3 hits
PROSITEiView protein in PROSITE
PS50853, FN3, 4 hits
PS50835, IG_LIKE, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIGFN1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86VF2
Secondary accession number(s): F8WAI1, Q9NT72
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: September 2, 2008
Last modified: June 2, 2021
This is version 158 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again