Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

CD163

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.
After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.

Miscellaneous

Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.
The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

Caution

It is uncertain whether Met-1 or Met-6 is the initiator.Curated

Kineticsi

  1. KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype1 Publication
  2. KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype1 Publication

    GO - Molecular functioni

    • scavenger receptor activity Source: ProtInc

    GO - Biological processi

    Keywordsi

    Biological processAcute phase, Inflammatory response

    Enzyme and pathway databases

    ReactomeiR-HSA-2168880 Scavenging of heme from plasma
    SIGNORiQ86VB7

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Scavenger receptor cysteine-rich type 1 protein M130
    Alternative name(s):
    Hemoglobin scavenger receptor
    CD_antigen: CD163
    Cleaved into the following chain:
    Soluble CD163
    Short name:
    sCD163
    Gene namesi
    Name:CD163
    Synonyms:M130
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 12

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000177575.12
    HGNCiHGNC:1631 CD163
    MIMi605545 gene
    neXtProtiNX_Q86VB7

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini42 – 1050ExtracellularSequence analysisAdd BLAST1009
    Transmembranei1051 – 1071HelicalSequence analysisAdd BLAST21
    Topological domaini1072 – 1156CytoplasmicSequence analysisAdd BLAST85

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi1072T → A: Impaired phosphorylation by PRKCA. 1 Publication1
    Mutagenesisi1084S → A: Impaired phosphorylation by PRKCA. 1 Publication1
    Mutagenesisi1096Y → A: Massive decrease of endocytotic activity. 1 Publication1

    Organism-specific databases

    DisGeNETi9332
    OpenTargetsiENSG00000177575
    PharmGKBiPA26190

    Chemistry databases

    DrugBankiDB05389 WF10

    Polymorphism and mutation databases

    BioMutaiCD163
    DMDMi313104083

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Signal peptidei1 – 41Sequence analysisAdd BLAST41
    ChainiPRO_000023893842 – 1156Scavenger receptor cysteine-rich type 1 protein M130Add BLAST1115
    ChainiPRO_000023893942 – ?Soluble CD163

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Disulfide bondi76 ↔ 141PROSITE-ProRule annotation
    Disulfide bondi89 ↔ 151PROSITE-ProRule annotation
    Glycosylationi105N-linked (GlcNAc...) (complex) asparagine3 Publications1
    Disulfide bondi120 ↔ 130PROSITE-ProRule annotation
    Glycosylationi140N-linked (GlcNAc...) asparagine1 Publication1
    Disulfide bondi184 ↔ 248PROSITE-ProRule annotation
    Disulfide bondi197 ↔ 258PROSITE-ProRule annotation
    Disulfide bondi228 ↔ 238PROSITE-ProRule annotation
    Disulfide bondi291 ↔ 355PROSITE-ProRule annotation
    Disulfide bondi304 ↔ 365PROSITE-ProRule annotation
    Disulfide bondi335 ↔ 345PROSITE-ProRule annotation
    Disulfide bondi398 ↔ 462PROSITE-ProRule annotation
    Disulfide bondi411 ↔ 472PROSITE-ProRule annotation
    Disulfide bondi442 ↔ 452PROSITE-ProRule annotation
    Disulfide bondi503 ↔ 567PROSITE-ProRule annotation
    Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
    Disulfide bondi547 ↔ 557PROSITE-ProRule annotation
    Disulfide bondi608 ↔ 672PROSITE-ProRule annotation
    Disulfide bondi621 ↔ 682PROSITE-ProRule annotation
    Disulfide bondi652 ↔ 662PROSITE-ProRule annotation
    Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
    Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
    Glycosylationi767N-linked (GlcNAc...) asparagine1 Publication1
    Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
    Disulfide bondi864 ↔ 925PROSITE-ProRule annotation
    Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
    Disulfide bondi954 ↔ 1018PROSITE-ProRule annotation
    Disulfide bondi967 ↔ 1028PROSITE-ProRule annotation
    Disulfide bondi998 ↔ 1008PROSITE-ProRule annotation
    Glycosylationi1027N-linked (GlcNAc...) asparagine1 Publication1

    Post-translational modificationi

    A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.4 Publications
    Phosphorylated.1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sitei269 – 270Cleavage; in calcium-free condition2
    Sitei281 – 282Cleavage; in calcium-free condition2
    Sitei333 – 334Cleavage; in calcium-free condition2
    Sitei360 – 361Cleavage; in calcium-free condition2

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ86VB7
    PeptideAtlasiQ86VB7
    PRIDEiQ86VB7
    ProteomicsDBi69982
    69983 [Q86VB7-2]
    69984 [Q86VB7-3]
    69985 [Q86VB7-4]

    PTM databases

    GlyConnecti1723
    iPTMnetiQ86VB7
    PhosphoSitePlusiQ86VB7

    Expressioni

    Tissue specificityi

    Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.3 Publications

    Inductioni

    Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF.2 Publications

    Gene expression databases

    BgeeiENSG00000177575 Expressed in 190 organ(s), highest expression level in esophagus
    CleanExiHS_CD163
    ExpressionAtlasiQ86VB7 baseline and differential
    GenevisibleiQ86VB7 HS

    Organism-specific databases

    HPAiCAB002432
    HPA046404
    HPA051974

    Interactioni

    Subunit structurei

    Interacts with CSNK2B.1 Publication

    Protein-protein interaction databases

    BioGridi114741, 2 interactors
    IntActiQ86VB7, 2 interactors
    STRINGi9606.ENSP00000352071

    Structurei

    3D structure databases

    ProteinModelPortaliQ86VB7
    SMRiQ86VB7
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Domaini51 – 152SRCR 1PROSITE-ProRule annotationAdd BLAST102
    Domaini159 – 259SRCR 2PROSITE-ProRule annotationAdd BLAST101
    Domaini266 – 366SRCR 3PROSITE-ProRule annotationAdd BLAST101
    Domaini373 – 473SRCR 4PROSITE-ProRule annotationAdd BLAST101
    Domaini478 – 578SRCR 5PROSITE-ProRule annotationAdd BLAST101
    Domaini583 – 683SRCR 6PROSITE-ProRule annotationAdd BLAST101
    Domaini719 – 819SRCR 7PROSITE-ProRule annotationAdd BLAST101
    Domaini824 – 926SRCR 8PROSITE-ProRule annotationAdd BLAST103
    Domaini929 – 1029SRCR 9PROSITE-ProRule annotationAdd BLAST101

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Motifi1096 – 1099Internalization signal4

    Domaini

    The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.1 Publication

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiENOG410IHBC Eukaryota
    ENOG410XQVR LUCA
    GeneTreeiENSGT00900000140803
    HOVERGENiHBG080943
    InParanoidiQ86VB7
    KOiK06545
    OMAiNWQWGGL
    OrthoDBiEOG091G0DF7
    PhylomeDBiQ86VB7
    TreeFamiTF329295

    Family and domain databases

    Gene3Di3.10.250.10, 9 hits
    InterProiView protein in InterPro
    IPR001190 SRCR
    IPR017448 SRCR-like_dom
    IPR036772 SRCR-like_dom_sf
    PfamiView protein in Pfam
    PF00530 SRCR, 9 hits
    PRINTSiPR00258 SPERACTRCPTR
    SMARTiView protein in SMART
    SM00202 SR, 9 hits
    SUPFAMiSSF56487 SSF56487, 9 hits
    PROSITEiView protein in PROSITE
    PS00420 SRCR_1, 4 hits
    PS50287 SRCR_2, 9 hits

    Sequences (4+)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q86VB7-1) [UniParc]FASTAAdd to basket
    Also known as: Long tail variant 1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE
    60 70 80 90 100
    LRLVDGENKC SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA
    110 120 130 140 150
    PGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT
    160 170 180 190 200
    CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW GTVCDDNFNI DHASVICRQL
    210 220 230 240 250
    ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH
    260 270 280 290 300
    AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA
    310 320 330 340 350
    AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW
    360 370 380 390 400
    GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR
    410 420 430 440 450
    GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNTWLFLS SCNGNETSLW
    460 470 480 490 500
    DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG
    510 520 530 540 550
    SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WAEEFQCEGH
    560 570 580 590 600
    ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT
    610 620 630 640 650
    LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF
    660 670 680 690 700
    HCTGTEQHMG DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP
    710 720 730 740 750
    TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL
    760 770 780 790 800
    SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS
    810 820 830 840 850
    HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGTV
    860 870 880 890 900
    GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD
    910 920 930 940 950
    TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW
    960 970 980 990 1000
    GTVCDDSWDL DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG
    1010 1020 1030 1040 1050
    NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS
    1060 1070 1080 1090 1100
    FIAVGILGVV LLAIFVALFF LTKKRRQRQR LAVSSRGENL VHQIQYREMN
    1110 1120 1130 1140 1150
    SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM EKEAILSHTE

    KENGNL
    Length:1,156
    Mass (Da):125,451
    Last modified:November 30, 2010 - v2
    Checksum:i57B49F76DA6C96EB
    GO
    Isoform 2 (identifier: Q86VB7-2) [UniParc]FASTAAdd to basket
    Also known as: Long tail variant 2

    The sequence of this isoform differs from the canonical sequence as follows:
         1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE

    Show »
    Length:1,161
    Mass (Da):125,982
    Checksum:iDD1C93863FD07979
    GO
    Isoform 3 (identifier: Q86VB7-3) [UniParc]FASTAAdd to basket
    Also known as: Short tail variant

    The sequence of this isoform differs from the canonical sequence as follows:
         1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

    Show »
    Length:1,121
    Mass (Da):121,609
    Checksum:i31279FC947960606
    GO
    Isoform 4 (identifier: Q86VB7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
         1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

    Show »
    Length:1,154
    Mass (Da):124,958
    Checksum:i8814E05FB2EDFE7B
    GO

    Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    F5GZZ9F5GZZ9_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    1,109Annotation score:
    C9JHR8C9JHR8_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    1,154Annotation score:
    H0YFM0H0YFM0_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    137Annotation score:
    H0YGZ7H0YGZ7_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    124Annotation score:

    Sequence cautioni

    The sequence CAA80541 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAA80542 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAA80543 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAA80544 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAB45233 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_026574342I → V4 PublicationsCorresponds to variant dbSNP:rs4883263Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_019013579R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4. 1 Publication1
    Alternative sequenceiVSP_0190141115 – 1156ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2. 1 PublicationAdd BLAST42
    Alternative sequenceiVSP_0190151115 – 1156ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4. 2 PublicationsAdd BLAST42

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    Z22968 mRNA Translation: CAA80541.1 Different initiation.
    Z22969 mRNA Translation: CAA80542.1 Different initiation.
    Z22970 mRNA Translation: CAA80543.1 Different initiation.
    Z22971 mRNA Translation: CAA80544.1 Different initiation.
    Y18388
    , Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA Translation: CAB45233.1 Different initiation.
    DQ058615 mRNA Translation: AAY99762.1
    AC131206 Genomic DNA No translation available.
    BC051281 mRNA Translation: AAH51281.1
    CCDSiCCDS53742.1 [Q86VB7-3]
    CCDS8578.1 [Q86VB7-1]
    PIRiI38004
    I38005
    I38006
    RefSeqiNP_004235.4, NM_004244.5 [Q86VB7-1]
    NP_981961.2, NM_203416.3 [Q86VB7-3]
    XP_016875720.1, XM_017020231.1
    UniGeneiHs.504641

    Genome annotation databases

    EnsembliENST00000359156; ENSP00000352071; ENSG00000177575 [Q86VB7-1]
    ENST00000432237; ENSP00000403885; ENSG00000177575 [Q86VB7-3]
    GeneIDi9332
    KEGGihsa:9332
    UCSCiuc001qsz.4 human [Q86VB7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    Z22968 mRNA Translation: CAA80541.1 Different initiation.
    Z22969 mRNA Translation: CAA80542.1 Different initiation.
    Z22970 mRNA Translation: CAA80543.1 Different initiation.
    Z22971 mRNA Translation: CAA80544.1 Different initiation.
    Y18388
    , Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA Translation: CAB45233.1 Different initiation.
    DQ058615 mRNA Translation: AAY99762.1
    AC131206 Genomic DNA No translation available.
    BC051281 mRNA Translation: AAH51281.1
    CCDSiCCDS53742.1 [Q86VB7-3]
    CCDS8578.1 [Q86VB7-1]
    PIRiI38004
    I38005
    I38006
    RefSeqiNP_004235.4, NM_004244.5 [Q86VB7-1]
    NP_981961.2, NM_203416.3 [Q86VB7-3]
    XP_016875720.1, XM_017020231.1
    UniGeneiHs.504641

    3D structure databases

    ProteinModelPortaliQ86VB7
    SMRiQ86VB7
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi114741, 2 interactors
    IntActiQ86VB7, 2 interactors
    STRINGi9606.ENSP00000352071

    Chemistry databases

    DrugBankiDB05389 WF10

    PTM databases

    GlyConnecti1723
    iPTMnetiQ86VB7
    PhosphoSitePlusiQ86VB7

    Polymorphism and mutation databases

    BioMutaiCD163
    DMDMi313104083

    Proteomic databases

    PaxDbiQ86VB7
    PeptideAtlasiQ86VB7
    PRIDEiQ86VB7
    ProteomicsDBi69982
    69983 [Q86VB7-2]
    69984 [Q86VB7-3]
    69985 [Q86VB7-4]

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000359156; ENSP00000352071; ENSG00000177575 [Q86VB7-1]
    ENST00000432237; ENSP00000403885; ENSG00000177575 [Q86VB7-3]
    GeneIDi9332
    KEGGihsa:9332
    UCSCiuc001qsz.4 human [Q86VB7-1]

    Organism-specific databases

    CTDi9332
    DisGeNETi9332
    EuPathDBiHostDB:ENSG00000177575.12
    GeneCardsiCD163
    HGNCiHGNC:1631 CD163
    HPAiCAB002432
    HPA046404
    HPA051974
    MIMi605545 gene
    neXtProtiNX_Q86VB7
    OpenTargetsiENSG00000177575
    PharmGKBiPA26190
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiENOG410IHBC Eukaryota
    ENOG410XQVR LUCA
    GeneTreeiENSGT00900000140803
    HOVERGENiHBG080943
    InParanoidiQ86VB7
    KOiK06545
    OMAiNWQWGGL
    OrthoDBiEOG091G0DF7
    PhylomeDBiQ86VB7
    TreeFamiTF329295

    Enzyme and pathway databases

    ReactomeiR-HSA-2168880 Scavenging of heme from plasma
    SIGNORiQ86VB7

    Miscellaneous databases

    ChiTaRSiCD163 human
    GeneWikiiCD163
    GenomeRNAii9332
    PROiPR:Q86VB7
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000177575 Expressed in 190 organ(s), highest expression level in esophagus
    CleanExiHS_CD163
    ExpressionAtlasiQ86VB7 baseline and differential
    GenevisibleiQ86VB7 HS

    Family and domain databases

    Gene3Di3.10.250.10, 9 hits
    InterProiView protein in InterPro
    IPR001190 SRCR
    IPR017448 SRCR-like_dom
    IPR036772 SRCR-like_dom_sf
    PfamiView protein in Pfam
    PF00530 SRCR, 9 hits
    PRINTSiPR00258 SPERACTRCPTR
    SMARTiView protein in SMART
    SM00202 SR, 9 hits
    SUPFAMiSSF56487 SSF56487, 9 hits
    PROSITEiView protein in PROSITE
    PS00420 SRCR_1, 4 hits
    PS50287 SRCR_2, 9 hits
    ProtoNetiSearch...

    Entry informationi

    Entry nameiC163A_HUMAN
    AccessioniPrimary (citable) accession number: Q86VB7
    Secondary accession number(s): C9JIG2
    , Q07898, Q07899, Q07900, Q07901, Q2VLH7
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
    Last sequence update: November 30, 2010
    Last modified: October 10, 2018
    This is version 131 of the entry and version 2 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    2. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    3. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again