Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q86VB7 (C163A_HUMAN)

Entry version 150 (29 Sep 2021)
Sequence version 2 (30 Nov 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

CD163

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.

After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.

Miscellaneous

Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.
The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

Caution

It is uncertain whether Met-1 or Met-6 is the initiator.Curated

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype1 Publication
  2. KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAcute phase, Inflammatory response

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q86VB7

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2168880, Scavenging of heme from plasma
R-HSA-9662834, CD163 mediating an anti-inflammatory response

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q86VB7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
Hemoglobin scavenger receptor
CD_antigen: CD163
Cleaved into the following chain:
Soluble CD163
Short name:
sCD163
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD163
Synonyms:M130
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1631, CD163

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605545, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q86VB7

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000177575

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini42 – 1050ExtracellularSequence analysisAdd BLAST1009
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1051 – 1071HelicalSequence analysisAdd BLAST21
Topological domaini1072 – 1156CytoplasmicSequence analysisAdd BLAST85

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1072T → A: Impaired phosphorylation by PRKCA. 1 Publication1
Mutagenesisi1084S → A: Impaired phosphorylation by PRKCA. 1 Publication1
Mutagenesisi1096Y → A: Massive decrease of endocytotic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		9332

Open Targets

More...OpenTargetsi		ENSG00000177575

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26190

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q86VB7, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB05389, Tetrachlorodecaoxide

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CD163

Domain mapping of disease mutations (DMDM)

More...DMDMi		313104083

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 41Sequence analysisAdd BLAST41
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000023893842 – 1156Scavenger receptor cysteine-rich type 1 protein M130Add BLAST1115
ChainiPRO_000023893942 – ?Soluble CD163

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi76 ↔ 141PROSITE-ProRule annotation
Disulfide bondi89 ↔ 151PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi105N-linked (GlcNAc...) (complex) asparagine3 Publications1
Disulfide bondi120 ↔ 130PROSITE-ProRule annotation
Glycosylationi140N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi184 ↔ 248PROSITE-ProRule annotation
Disulfide bondi197 ↔ 258PROSITE-ProRule annotation
Disulfide bondi228 ↔ 238PROSITE-ProRule annotation
Disulfide bondi291 ↔ 355PROSITE-ProRule annotation
Disulfide bondi304 ↔ 365PROSITE-ProRule annotation
Disulfide bondi335 ↔ 345PROSITE-ProRule annotation
Disulfide bondi398 ↔ 462PROSITE-ProRule annotation
Disulfide bondi411 ↔ 472PROSITE-ProRule annotation
Disulfide bondi442 ↔ 452PROSITE-ProRule annotation
Disulfide bondi503 ↔ 567PROSITE-ProRule annotation
Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
Disulfide bondi547 ↔ 557PROSITE-ProRule annotation
Disulfide bondi608 ↔ 672PROSITE-ProRule annotation
Disulfide bondi621 ↔ 682PROSITE-ProRule annotation
Disulfide bondi652 ↔ 662PROSITE-ProRule annotation
Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
Glycosylationi767N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
Disulfide bondi864 ↔ 925PROSITE-ProRule annotation
Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
Disulfide bondi954 ↔ 1018PROSITE-ProRule annotation
Disulfide bondi967 ↔ 1028PROSITE-ProRule annotation
Disulfide bondi998 ↔ 1008PROSITE-ProRule annotation
Glycosylationi1027N-linked (GlcNAc...) asparagine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.4 Publications
Phosphorylated.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei269 – 270Cleavage; in calcium-free condition2
Sitei281 – 282Cleavage; in calcium-free condition2
Sitei333 – 334Cleavage; in calcium-free condition2
Sitei360 – 361Cleavage; in calcium-free condition2

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q86VB7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q86VB7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q86VB7

PeptideAtlas

More...PeptideAtlasi		Q86VB7

PRoteomics IDEntifications database

More...PRIDEi		Q86VB7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		69982 [Q86VB7-1]
69983 [Q86VB7-2]
69984 [Q86VB7-3]
69985 [Q86VB7-4]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1723, 14 N-Linked glycans (6 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q86VB7, 11 sites, 14 N-linked glycans (6 sites), 2 O-linked glycans (3 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q86VB7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q86VB7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.3 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000177575, Expressed in esophagus and 204 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q86VB7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q86VB7, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000177575, Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CSNK2B.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114741, 4 interactors

Protein interaction database and analysis system

More...IntActi		Q86VB7, 5 interactors

Molecular INTeraction database

More...MINTi		Q86VB7

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000352071

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q86VB7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q86VB7

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini51 – 152SRCR 1PROSITE-ProRule annotationAdd BLAST102
Domaini159 – 259SRCR 2PROSITE-ProRule annotationAdd BLAST101
Domaini266 – 366SRCR 3PROSITE-ProRule annotationAdd BLAST101
Domaini373 – 473SRCR 4PROSITE-ProRule annotationAdd BLAST101
Domaini478 – 578SRCR 5PROSITE-ProRule annotationAdd BLAST101
Domaini583 – 683SRCR 6PROSITE-ProRule annotationAdd BLAST101
Domaini719 – 819SRCR 7PROSITE-ProRule annotationAdd BLAST101
Domaini824 – 926SRCR 8PROSITE-ProRule annotationAdd BLAST103
Domaini929 – 1029SRCR 9PROSITE-ProRule annotationAdd BLAST101

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1096 – 1099Internalization signal4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.1 Publication

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QQ5W, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155987

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002555_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q86VB7

Identification of Orthologs from Complete Genome Data

More...OMAi		VQYREMN

Database of Orthologous Groups

More...OrthoDBi		1095487at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q86VB7

TreeFam database of animal gene trees

More...TreeFami		TF329295

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.10.250.10, 9 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001190, SRCR
IPR017448, SRCR-like_dom
IPR036772, SRCR-like_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00530, SRCR, 9 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00258, SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00202, SR, 9 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56487, SSF56487, 9 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00420, SRCR_1, 4 hits
PS50287, SRCR_2, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86VB7-1) [UniParc]FASTAAdd to basket
Also known as: Long tail variant 1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE 
        60         70         80         90        100
LRLVDGENKC SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA 
       110        120        130        140        150
PGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT 
       160        170        180        190        200
CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW GTVCDDNFNI DHASVICRQL 
       210        220        230        240        250
ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH 
       260        270        280        290        300
AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA 
       310        320        330        340        350
AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW 
       360        370        380        390        400
GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR 
       410        420        430        440        450
GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNTWLFLS SCNGNETSLW 
       460        470        480        490        500
DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG 
       510        520        530        540        550
SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WAEEFQCEGH 
       560        570        580        590        600
ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT 
       610        620        630        640        650
LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF 
       660        670        680        690        700
HCTGTEQHMG DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP 
       710        720        730        740        750
TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL 
       760        770        780        790        800
SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS 
       810        820        830        840        850
HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGTV 
       860        870        880        890        900
GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD 
       910        920        930        940        950
TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW 
       960        970        980        990       1000
GTVCDDSWDL DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG 
      1010       1020       1030       1040       1050
NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS 
      1060       1070       1080       1090       1100
FIAVGILGVV LLAIFVALFF LTKKRRQRQR LAVSSRGENL VHQIQYREMN 
      1110       1120       1130       1140       1150
SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM EKEAILSHTE 

KENGNL
Length:1,156
Mass (Da):125,451
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i57B49F76DA6C96EB
GO
Isoform 2 (identifier: Q86VB7-2) [UniParc]FASTAAdd to basket
Also known as: Long tail variant 2

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE

Show »
Length:1,161
Mass (Da):125,982
Checksum:iDD1C93863FD07979
GO
Isoform 3 (identifier: Q86VB7-3) [UniParc]FASTAAdd to basket
Also known as: Short tail variant

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Show »
Length:1,121
Mass (Da):121,609
Checksum:i31279FC947960606
GO
Isoform 4 (identifier: Q86VB7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Show »
Length:1,154
Mass (Da):124,958
Checksum:i8814E05FB2EDFE7B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GZZ9F5GZZ9_HUMAN
Scavenger receptor cysteine-rich ty...
CD163
1,109Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JHR8C9JHR8_HUMAN
Scavenger receptor cysteine-rich ty...
CD163
1,154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFM0H0YFM0_HUMAN
Scavenger receptor cysteine-rich ty...
CD163
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGZ7H0YGZ7_HUMAN
Scavenger receptor cysteine-rich ty...
CD163
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA80541 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA80542 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA80543 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA80544 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAB45233 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026574342I → V4 PublicationsCorresponds to variant dbSNP:rs4883263Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019013579R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4. 1 Publication1
Alternative sequenceiVSP_0190141115 – 1156ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_0190151115 – 1156ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4. 2 PublicationsAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z22968 mRNA Translation: CAA80541.1 Different initiation.
Z22969 mRNA Translation: CAA80542.1 Different initiation.
Z22970 mRNA Translation: CAA80543.1 Different initiation.
Z22971 mRNA Translation: CAA80544.1 Different initiation.
Y18388 Y18403 Genomic DNA Translation: CAB45233.1 Different initiation.
DQ058615 mRNA Translation: AAY99762.1
AC131206 Genomic DNA No translation available.
BC051281 mRNA Translation: AAH51281.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53742.1 [Q86VB7-3]
CCDS8578.1 [Q86VB7-1]

Protein sequence database of the Protein Information Resource

More...PIRi		I38004
I38005
I38006

NCBI Reference Sequences

More...RefSeqi		NP_004235.4, NM_004244.5 [Q86VB7-1]
NP_981961.2, NM_203416.3 [Q86VB7-3]
XP_016875720.1, XM_017020231.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000359156; ENSP00000352071; ENSG00000177575 [Q86VB7-1]
ENST00000432237; ENSP00000403885; ENSG00000177575 [Q86VB7-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9332

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9332

UCSC genome browser

More...UCSCi		uc001qsz.4, human [Q86VB7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22968 mRNA Translation: CAA80541.1 Different initiation.
Z22969 mRNA Translation: CAA80542.1 Different initiation.
Z22970 mRNA Translation: CAA80543.1 Different initiation.
Z22971 mRNA Translation: CAA80544.1 Different initiation.
Y18388 Y18403 Genomic DNA Translation: CAB45233.1 Different initiation.
DQ058615 mRNA Translation: AAY99762.1
AC131206 Genomic DNA No translation available.
BC051281 mRNA Translation: AAH51281.1
CCDSiCCDS53742.1 [Q86VB7-3]
CCDS8578.1 [Q86VB7-1]
PIRiI38004
I38005
I38006
RefSeqiNP_004235.4, NM_004244.5 [Q86VB7-1]
NP_981961.2, NM_203416.3 [Q86VB7-3]
XP_016875720.1, XM_017020231.1

3D structure databases

SMRiQ86VB7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114741, 4 interactors
IntActiQ86VB7, 5 interactors
MINTiQ86VB7
STRINGi9606.ENSP00000352071

Chemistry databases

DrugBankiDB05389, Tetrachlorodecaoxide

PTM databases

GlyConnecti1723, 14 N-Linked glycans (6 sites)
GlyGeniQ86VB7, 11 sites, 14 N-linked glycans (6 sites), 2 O-linked glycans (3 sites)
iPTMnetiQ86VB7
PhosphoSitePlusiQ86VB7

Genetic variation databases

BioMutaiCD163
DMDMi313104083

Proteomic databases

jPOSTiQ86VB7
MassIVEiQ86VB7
PaxDbiQ86VB7
PeptideAtlasiQ86VB7
PRIDEiQ86VB7
ProteomicsDBi69982 [Q86VB7-1]
69983 [Q86VB7-2]
69984 [Q86VB7-3]
69985 [Q86VB7-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3721, 1511 antibodies

The CPTC Antibody Portal

More...CPTCi		Q86VB7, 1 antibody

The DNASU plasmid repository

More...DNASUi		9332

Genome annotation databases

EnsembliENST00000359156; ENSP00000352071; ENSG00000177575 [Q86VB7-1]
ENST00000432237; ENSP00000403885; ENSG00000177575 [Q86VB7-3]
GeneIDi9332
KEGGihsa:9332
UCSCiuc001qsz.4, human [Q86VB7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9332
DisGeNETi9332

GeneCards: human genes, protein and diseases

More...GeneCardsi		CD163
HGNCiHGNC:1631, CD163
HPAiENSG00000177575, Tissue enhanced (lymphoid)
MIMi605545, gene
neXtProtiNX_Q86VB7
OpenTargetsiENSG00000177575
PharmGKBiPA26190
VEuPathDBiHostDB:ENSG00000177575

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QQ5W, Eukaryota
GeneTreeiENSGT00940000155987
HOGENOMiCLU_002555_0_1_1
InParanoidiQ86VB7
OMAiVQYREMN
OrthoDBi1095487at2759
PhylomeDBiQ86VB7
TreeFamiTF329295

Enzyme and pathway databases

PathwayCommonsiQ86VB7
ReactomeiR-HSA-2168880, Scavenging of heme from plasma
R-HSA-9662834, CD163 mediating an anti-inflammatory response
SIGNORiQ86VB7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9332, 6 hits in 1004 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CD163, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CD163

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9332
PharosiQ86VB7, Tbio

Protein Ontology

More...PROi		PR:Q86VB7
RNActiQ86VB7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000177575, Expressed in esophagus and 204 other tissues
ExpressionAtlasiQ86VB7, baseline and differential
GenevisibleiQ86VB7, HS

Family and domain databases

Gene3Di3.10.250.10, 9 hits
InterProiView protein in InterPro
IPR001190, SRCR
IPR017448, SRCR-like_dom
IPR036772, SRCR-like_dom_sf
PfamiView protein in Pfam
PF00530, SRCR, 9 hits
PRINTSiPR00258, SPERACTRCPTR
SMARTiView protein in SMART
SM00202, SR, 9 hits
SUPFAMiSSF56487, SSF56487, 9 hits
PROSITEiView protein in PROSITE
PS00420, SRCR_1, 4 hits
PS50287, SRCR_2, 9 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC163A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86VB7
Secondary accession number(s): C9JIG2
, Q07898, Q07899, Q07900, Q07901, Q2VLH7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: November 30, 2010
Last modified: September 29, 2021
This is version 150 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again