Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q86VB7 (C163A_HUMAN)

Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

CD163

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.
After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.

Miscellaneous

Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.
The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

Caution

It is uncertain whether Met-1 or Met-6 is the initiator.Curated

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype1 Publication
  2. KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype1 Publication

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    • scavenger receptor activity Source: ProtInc
    View the complete GO annotation on QuickGO ...

    GO - Biological processi

    View the complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Biological processAcute phase, Inflammatory response

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...    Reactomei    		R-HSA-2168880 Scavenging of heme from plasma

    SIGNOR Signaling Network Open Resource

    More...    SIGNORi    		Q86VB7

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Scavenger receptor cysteine-rich type 1 protein M130
    Alternative name(s):
    Hemoglobin scavenger receptor
    CD_antigen: CD163
    Cleaved into the following chain:
    Soluble CD163
    Short name:
    sCD163
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:CD163
    Synonyms:M130
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...    EuPathDBi    		HostDB:ENSG00000177575.12

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:1631 CD163

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		605545 gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_Q86VB7

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini42 – 1050ExtracellularSequence analysisAdd BLAST1009
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1051 – 1071HelicalSequence analysisAdd BLAST21
    Topological domaini1072 – 1156CytoplasmicSequence analysisAdd BLAST85

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1072T → A: Impaired phosphorylation by PRKCA. 1 Publication1
    Mutagenesisi1084S → A: Impaired phosphorylation by PRKCA. 1 Publication1
    Mutagenesisi1096Y → A: Massive decrease of endocytotic activity. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		9332

    Open Targets

    More...    OpenTargetsi    		ENSG00000177575

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA26190

    Chemistry databases

    Drug and drug target database

    More...    DrugBanki    		DB05389 WF10

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		CD163

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		313104083

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 41Sequence analysisAdd BLAST41
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000023893842 – 1156Scavenger receptor cysteine-rich type 1 protein M130Add BLAST1115
    ChainiPRO_000023893942 – ?Soluble CD163

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi76 ↔ 141PROSITE-ProRule annotation
    Disulfide bondi89 ↔ 151PROSITE-ProRule annotation
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi105N-linked (GlcNAc...) (complex) asparagine3 Publications1
    Disulfide bondi120 ↔ 130PROSITE-ProRule annotation
    Glycosylationi140N-linked (GlcNAc...) asparagine1 Publication1
    Disulfide bondi184 ↔ 248PROSITE-ProRule annotation
    Disulfide bondi197 ↔ 258PROSITE-ProRule annotation
    Disulfide bondi228 ↔ 238PROSITE-ProRule annotation
    Disulfide bondi291 ↔ 355PROSITE-ProRule annotation
    Disulfide bondi304 ↔ 365PROSITE-ProRule annotation
    Disulfide bondi335 ↔ 345PROSITE-ProRule annotation
    Disulfide bondi398 ↔ 462PROSITE-ProRule annotation
    Disulfide bondi411 ↔ 472PROSITE-ProRule annotation
    Disulfide bondi442 ↔ 452PROSITE-ProRule annotation
    Disulfide bondi503 ↔ 567PROSITE-ProRule annotation
    Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
    Disulfide bondi547 ↔ 557PROSITE-ProRule annotation
    Disulfide bondi608 ↔ 672PROSITE-ProRule annotation
    Disulfide bondi621 ↔ 682PROSITE-ProRule annotation
    Disulfide bondi652 ↔ 662PROSITE-ProRule annotation
    Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
    Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
    Glycosylationi767N-linked (GlcNAc...) asparagine1 Publication1
    Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
    Disulfide bondi864 ↔ 925PROSITE-ProRule annotation
    Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
    Disulfide bondi954 ↔ 1018PROSITE-ProRule annotation
    Disulfide bondi967 ↔ 1028PROSITE-ProRule annotation
    Disulfide bondi998 ↔ 1008PROSITE-ProRule annotation
    Glycosylationi1027N-linked (GlcNAc...) asparagine1 Publication1

    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

    A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.4 Publications
    Phosphorylated.1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei269 – 270Cleavage; in calcium-free condition2
    Sitei281 – 282Cleavage; in calcium-free condition2
    Sitei333 – 334Cleavage; in calcium-free condition2
    Sitei360 – 361Cleavage; in calcium-free condition2

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		Q86VB7

    PeptideAtlas

    More...    PeptideAtlasi    		Q86VB7

    PRoteomics IDEntifications database

    More...    PRIDEi    		Q86VB7

    ProteomicsDB human proteome resource

    More...    ProteomicsDBi    		69982
    69983 [Q86VB7-2]
    69984 [Q86VB7-3]
    69985 [Q86VB7-4]

    PTM databases

    GlyConnect protein glycosylation platform

    More...    GlyConnecti    		1723

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		Q86VB7

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		Q86VB7

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.3 Publications

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF.2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000177575 Expressed in 190 organ(s), highest expression level in esophagus

    CleanEx database of gene expression profiles

    More...    CleanExi    		HS_CD163

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		Q86VB7 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		Q86VB7 HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		CAB002432
    HPA046404
    HPA051974

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with CSNK2B.1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...    BioGridi    		114741, 2 interactors

    Protein interaction database and analysis system

    More...    IntActi    		Q86VB7, 2 interactors

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000352071

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...    ProteinModelPortali    		Q86VB7

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		Q86VB7

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini51 – 152SRCR 1PROSITE-ProRule annotationAdd BLAST102
    Domaini159 – 259SRCR 2PROSITE-ProRule annotationAdd BLAST101
    Domaini266 – 366SRCR 3PROSITE-ProRule annotationAdd BLAST101
    Domaini373 – 473SRCR 4PROSITE-ProRule annotationAdd BLAST101
    Domaini478 – 578SRCR 5PROSITE-ProRule annotationAdd BLAST101
    Domaini583 – 683SRCR 6PROSITE-ProRule annotationAdd BLAST101
    Domaini719 – 819SRCR 7PROSITE-ProRule annotationAdd BLAST101
    Domaini824 – 926SRCR 8PROSITE-ProRule annotationAdd BLAST103
    Domaini929 – 1029SRCR 9PROSITE-ProRule annotationAdd BLAST101

    Motif

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1096 – 1099Internalization signal4

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.1 Publication

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		ENOG410IHBC Eukaryota
    ENOG410XQVR LUCA

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000155987

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...    HOVERGENi    		HBG080943

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		Q86VB7

    KEGG Orthology (KO)

    More...    KOi    		K06545

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		LEVKFQG

    Database of Orthologous Groups

    More...    OrthoDBi    		EOG091G0DF7

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		Q86VB7

    TreeFam database of animal gene trees

    More...    TreeFami    		TF329295

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		3.10.250.10, 9 hits

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR001190 SRCR
    IPR017448 SRCR-like_dom
    IPR036772 SRCR-like_dom_sf

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF00530 SRCR, 9 hits

    Protein Motif fingerprint database; a protein domain database

    More...    PRINTSi    		PR00258 SPERACTRCPTR

    Simple Modular Architecture Research Tool; a protein domain database

    More...    SMARTi    		View protein in SMART
    SM00202 SR, 9 hits

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF56487 SSF56487, 9 hits

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS00420 SRCR_1, 4 hits
    PS50287 SRCR_2, 9 hits

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q86VB7-1) [UniParc]FASTAAdd to basket
    Also known as: Long tail variant 1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE 
            60         70         80         90        100
    LRLVDGENKC SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA 
           110        120        130        140        150
    PGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT 
           160        170        180        190        200
    CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW GTVCDDNFNI DHASVICRQL 
           210        220        230        240        250
    ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH 
           260        270        280        290        300
    AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA 
           310        320        330        340        350
    AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW 
           360        370        380        390        400
    GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR 
           410        420        430        440        450
    GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNTWLFLS SCNGNETSLW 
           460        470        480        490        500
    DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG 
           510        520        530        540        550
    SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WAEEFQCEGH 
           560        570        580        590        600
    ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT 
           610        620        630        640        650
    LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF 
           660        670        680        690        700
    HCTGTEQHMG DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP 
           710        720        730        740        750
    TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL 
           760        770        780        790        800
    SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS 
           810        820        830        840        850
    HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGTV 
           860        870        880        890        900
    GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD 
           910        920        930        940        950
    TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW 
           960        970        980        990       1000
    GTVCDDSWDL DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG 
          1010       1020       1030       1040       1050
    NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS 
          1060       1070       1080       1090       1100
    FIAVGILGVV LLAIFVALFF LTKKRRQRQR LAVSSRGENL VHQIQYREMN 
          1110       1120       1130       1140       1150
    SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM EKEAILSHTE 

    KENGNL
    Length:1,156
    Mass (Da):125,451
    Last modified:November 30, 2010 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i57B49F76DA6C96EB
    GO
    Isoform 2 (identifier: Q86VB7-2) [UniParc]FASTAAdd to basket
    Also known as: Long tail variant 2

    The sequence of this isoform differs from the canonical sequence as follows:
         1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE

    Show »
    Length:1,161
    Mass (Da):125,982
    Checksum:iDD1C93863FD07979
    GO
    Isoform 3 (identifier: Q86VB7-3) [UniParc]FASTAAdd to basket
    Also known as: Short tail variant

    The sequence of this isoform differs from the canonical sequence as follows:
         1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

    Show »
    Length:1,121
    Mass (Da):121,609
    Checksum:i31279FC947960606
    GO
    Isoform 4 (identifier: Q86VB7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
         1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

    Show »
    Length:1,154
    Mass (Da):124,958
    Checksum:i8814E05FB2EDFE7B
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    F5GZZ9F5GZZ9_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    		1,109Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9JHR8C9JHR8_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    		1,154Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YFM0H0YFM0_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    		137Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H0YGZ7H0YGZ7_HUMAN
    Scavenger receptor cysteine-rich ty...
    CD163
    		124Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence CAA80541 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAA80542 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAA80543 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAA80544 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence CAB45233 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026574342I → V4 PublicationsCorresponds to variant dbSNP:rs4883263Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019013579R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4. 1 Publication1
    Alternative sequenceiVSP_0190141115 – 1156ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2. 1 PublicationAdd BLAST42
    Alternative sequenceiVSP_0190151115 – 1156ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4. 2 PublicationsAdd BLAST42

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		Z22968 mRNA Translation: CAA80541.1 Different initiation.
    Z22969 mRNA Translation: CAA80542.1 Different initiation.
    Z22970 mRNA Translation: CAA80543.1 Different initiation.
    Z22971 mRNA Translation: CAA80544.1 Different initiation.
    Y18388
    , Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA Translation: CAB45233.1 Different initiation.
    DQ058615 mRNA Translation: AAY99762.1
    AC131206 Genomic DNA No translation available.
    BC051281 mRNA Translation: AAH51281.1

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS53742.1 [Q86VB7-3]
    CCDS8578.1 [Q86VB7-1]

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		I38004
    I38005
    I38006

    NCBI Reference Sequences

    More...    RefSeqi    		NP_004235.4, NM_004244.5 [Q86VB7-1]
    NP_981961.2, NM_203416.3 [Q86VB7-3]
    XP_016875720.1, XM_017020231.1

    UniGene gene-oriented nucleotide sequence clusters

    More...    UniGenei    		Hs.504641

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000359156; ENSP00000352071; ENSG00000177575 [Q86VB7-1]
    ENST00000432237; ENSP00000403885; ENSG00000177575 [Q86VB7-3]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		9332

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:9332

    UCSC genome browser

    More...    UCSCi    		uc001qsz.4 human [Q86VB7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		Z22968 mRNA Translation: CAA80541.1 Different initiation.
    Z22969 mRNA Translation: CAA80542.1 Different initiation.
    Z22970 mRNA Translation: CAA80543.1 Different initiation.
    Z22971 mRNA Translation: CAA80544.1 Different initiation.
    Y18388
    , Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA Translation: CAB45233.1 Different initiation.
    DQ058615 mRNA Translation: AAY99762.1
    AC131206 Genomic DNA No translation available.
    BC051281 mRNA Translation: AAH51281.1
    CCDSiCCDS53742.1 [Q86VB7-3]
    CCDS8578.1 [Q86VB7-1]
    PIRiI38004
    I38005
    I38006
    RefSeqiNP_004235.4, NM_004244.5 [Q86VB7-1]
    NP_981961.2, NM_203416.3 [Q86VB7-3]
    XP_016875720.1, XM_017020231.1
    UniGeneiHs.504641

    3D structure databases

    ProteinModelPortaliQ86VB7
    SMRiQ86VB7
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi114741, 2 interactors
    IntActiQ86VB7, 2 interactors
    STRINGi9606.ENSP00000352071

    Chemistry databases

    DrugBankiDB05389 WF10

    PTM databases

    GlyConnecti1723
    iPTMnetiQ86VB7
    PhosphoSitePlusiQ86VB7

    Polymorphism and mutation databases

    BioMutaiCD163
    DMDMi313104083

    Proteomic databases

    PaxDbiQ86VB7
    PeptideAtlasiQ86VB7
    PRIDEiQ86VB7
    ProteomicsDBi69982
    69983 [Q86VB7-2]
    69984 [Q86VB7-3]
    69985 [Q86VB7-4]

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000359156; ENSP00000352071; ENSG00000177575 [Q86VB7-1]
    ENST00000432237; ENSP00000403885; ENSG00000177575 [Q86VB7-3]
    GeneIDi9332
    KEGGihsa:9332
    UCSCiuc001qsz.4 human [Q86VB7-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		9332
    DisGeNETi9332
    EuPathDBiHostDB:ENSG00000177575.12

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		CD163
    HGNCiHGNC:1631 CD163
    HPAiCAB002432
    HPA046404
    HPA051974
    MIMi605545 gene
    neXtProtiNX_Q86VB7
    OpenTargetsiENSG00000177575
    PharmGKBiPA26190

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiENOG410IHBC Eukaryota
    ENOG410XQVR LUCA
    GeneTreeiENSGT00940000155987
    HOVERGENiHBG080943
    InParanoidiQ86VB7
    KOiK06545
    OMAiLEVKFQG
    OrthoDBiEOG091G0DF7
    PhylomeDBiQ86VB7
    TreeFamiTF329295

    Enzyme and pathway databases

    ReactomeiR-HSA-2168880 Scavenging of heme from plasma
    SIGNORiQ86VB7

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		CD163 human

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		CD163

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		9332

    Protein Ontology

    More...    PROi    		PR:Q86VB7

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000177575 Expressed in 190 organ(s), highest expression level in esophagus
    CleanExiHS_CD163
    ExpressionAtlasiQ86VB7 baseline and differential
    GenevisibleiQ86VB7 HS

    Family and domain databases

    Gene3Di3.10.250.10, 9 hits
    InterProiView protein in InterPro
    IPR001190 SRCR
    IPR017448 SRCR-like_dom
    IPR036772 SRCR-like_dom_sf
    PfamiView protein in Pfam
    PF00530 SRCR, 9 hits
    PRINTSiPR00258 SPERACTRCPTR
    SMARTiView protein in SMART
    SM00202 SR, 9 hits
    SUPFAMiSSF56487 SSF56487, 9 hits
    PROSITEiView protein in PROSITE
    PS00420 SRCR_1, 4 hits
    PS50287 SRCR_2, 9 hits

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC163A_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86VB7
    Secondary accession number(s): C9JIG2
    , Q07898, Q07899, Q07900, Q07901, Q2VLH7
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
    Last sequence update: November 30, 2010
    Last modified: December 5, 2018
    This is version 133 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again