Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Magnesium-dependent phosphatase 1

Gene

MDP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by vanadate and zinc, and slightly by calcium.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei11NucleophileBy similarity1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi11MagnesiumBy similarity1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei12Phosphate; via amide nitrogenBy similarity1
Active sitei13Proton donorBy similarity1
Metal bindingi13MagnesiumBy similarity1
Binding sitei13Phosphate; via amide nitrogenBy similarity1
Binding sitei20SubstrateBy similarity1
Binding sitei69PhosphateBy similarity1
Binding sitei70PhosphateBy similarity1
Binding sitei70SubstrateBy similarity1
Binding sitei100PhosphateBy similarity1
Metal bindingi123MagnesiumBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
LigandMagnesium, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Magnesium-dependent phosphatase 1 (EC:3.1.3.-, EC:3.1.3.48)
Short name:
MDP-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MDP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000213920.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28781 MDP1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86V88

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000213920

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165479165

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MDP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74727544

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000688271 – 176Magnesium-dependent phosphatase 1Add BLAST176

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86V88

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q86V88

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q86V88

PeptideAtlas

More...
PeptideAtlasi
Q86V88

PRoteomics IDEntifications database

More...
PRIDEi
Q86V88

ProteomicsDB human proteome resource

More...
ProteomicsDBi
69978
69979 [Q86V88-2]
69980 [Q86V88-3]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q86V88

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86V88

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86V88

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000213920 Expressed in 88 organ(s), highest expression level in C1 segment of cervical spinal cord

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86V88 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003064
HPA070338

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126921, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000288087

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1176
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q86V88

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86V88

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q86V88

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the HAD-like hydrolase superfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4549 Eukaryota
ENOG4111PHW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004110

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000216653

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG081971

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86V88

KEGG Orthology (KO)

More...
KOi
K17619

Identification of Orthologs from Complete Genome Data

More...
OMAi
PLWIDTH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0SQ5

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86V88

TreeFam database of animal gene trees

More...
TreeFami
TF328413

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07501 HAD_MDP-1_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR010033 HAD_SF_ppase_IIIC
IPR035679 MDP-1_euk
IPR010036 MDP_1_eu_arc

The PANTHER Classification System

More...
PANTHERi
PTHR17901 PTHR17901, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12689 Acid_PPase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784 SSF56784, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01681 HAD-SF-IIIC, 1 hit
TIGR01685 MDP-1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q86V88-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARLPKLAVF DLDYTLWPFW VDTHVDPPFH KSSDGTVRDR RGQDVRLYPE
60 70 80 90 100
VPEVLKRLQS LGVPGAAASR TSEIEGANQL LELFDLFRYF VHREIYPGSK
110 120 130 140 150
ITHFERLQQK TGIPFSQMIF FDDERRNIVD VSKLGVTCIH IQNGMNLQTL
160 170
SQGLETFAKA QTGPLRSSLE ESPFEA
Length:176
Mass (Da):20,109
Last modified:June 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB0A33BD02458B2EF
GO
Isoform 2 (identifier: Q86V88-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY
     128-176: Missing.

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):14,818
Checksum:i3203C1FE34BB9CA2
GO
Isoform 3 (identifier: Q86V88-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP
     123-176: Missing.

Note: No experimental confirmation available.
Show »
Length:122
Mass (Da):14,038
Checksum:iB016158C63765443
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01598589 – 122YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_015986107 – 127LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_015988123 – 176Missing in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_015987128 – 176Missing in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK092821 mRNA Translation: BAC03984.1
BC046912 mRNA Translation: AAH46912.1
BC051382 mRNA Translation: AAH51382.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55908.1 [Q86V88-3]
CCDS9620.1 [Q86V88-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001186750.1, NM_001199821.1 [Q86V88-3]
NP_612485.2, NM_138476.3 [Q86V88-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.220963

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288087; ENSP00000288087; ENSG00000213920 [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920 [Q86V88-3]
ENST00000644853; ENSP00000493831; ENSG00000285200 [Q86V88-3]
ENST00000646165; ENSP00000494235; ENSG00000285200 [Q86V88-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
145553

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:145553

UCSC genome browser

More...
UCSCi
uc001wnl.3 human [Q86V88-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092821 mRNA Translation: BAC03984.1
BC046912 mRNA Translation: AAH46912.1
BC051382 mRNA Translation: AAH51382.1
CCDSiCCDS55908.1 [Q86V88-3]
CCDS9620.1 [Q86V88-1]
RefSeqiNP_001186750.1, NM_001199821.1 [Q86V88-3]
NP_612485.2, NM_138476.3 [Q86V88-1]
UniGeneiHs.220963

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WM8X-ray1.75A1-165[»]
ProteinModelPortaliQ86V88
SMRiQ86V88
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126921, 2 interactors
STRINGi9606.ENSP00000288087

PTM databases

DEPODiQ86V88
iPTMnetiQ86V88
PhosphoSitePlusiQ86V88

Polymorphism and mutation databases

BioMutaiMDP1
DMDMi74727544

Proteomic databases

EPDiQ86V88
MaxQBiQ86V88
PaxDbiQ86V88
PeptideAtlasiQ86V88
PRIDEiQ86V88
ProteomicsDBi69978
69979 [Q86V88-2]
69980 [Q86V88-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
145553
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288087; ENSP00000288087; ENSG00000213920 [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920 [Q86V88-3]
ENST00000644853; ENSP00000493831; ENSG00000285200 [Q86V88-3]
ENST00000646165; ENSP00000494235; ENSG00000285200 [Q86V88-1]
GeneIDi145553
KEGGihsa:145553
UCSCiuc001wnl.3 human [Q86V88-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
145553
EuPathDBiHostDB:ENSG00000213920.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MDP1
HGNCiHGNC:28781 MDP1
HPAiHPA003064
HPA070338
neXtProtiNX_Q86V88
OpenTargetsiENSG00000213920
PharmGKBiPA165479165

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4549 Eukaryota
ENOG4111PHW LUCA
GeneTreeiENSGT00390000004110
HOGENOMiHOG000216653
HOVERGENiHBG081971
InParanoidiQ86V88
KOiK17619
OMAiPLWIDTH
OrthoDBiEOG091G0SQ5
PhylomeDBiQ86V88
TreeFamiTF328413

Miscellaneous databases

EvolutionaryTraceiQ86V88

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
145553

Protein Ontology

More...
PROi
PR:Q86V88

Gene expression databases

BgeeiENSG00000213920 Expressed in 88 organ(s), highest expression level in C1 segment of cervical spinal cord
GenevisibleiQ86V88 HS

Family and domain databases

CDDicd07501 HAD_MDP-1_like, 1 hit
Gene3Di3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR010033 HAD_SF_ppase_IIIC
IPR035679 MDP-1_euk
IPR010036 MDP_1_eu_arc
PANTHERiPTHR17901 PTHR17901, 1 hit
PfamiView protein in Pfam
PF12689 Acid_PPase, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR01681 HAD-SF-IIIC, 1 hit
TIGR01685 MDP-1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGDP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86V88
Secondary accession number(s): Q86Y84, Q8NAD9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: June 1, 2003
Last modified: December 5, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again