Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (12 Aug 2020)
Sequence version 2 (12 Apr 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tubulinyl-Tyr carboxypeptidase 2

Gene

VASH2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146869). Critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning (PubMed:31171830). Acts as an activator of angiogenesis: expressed in infiltrating mononuclear cells in the sprouting front to promote angiogenesis (PubMed:19204325). Plays a role in axon formation (PubMed:31235911).3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1581 Publication1 Publication1
Active sitei1931 Publication1
Active sitei2101 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Protease

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q86V25

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubulinyl-Tyr carboxypeptidase 2Curated (EC:3.4.17.172 Publications)
Alternative name(s):
Vasohibin-21 Publication
Vasohibin-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VASH2Imported
Synonyms:VASHL
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143494.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25723, VASH2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610471, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q86V25

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi63 – 67WERMW → EERME: Disrupted interaction with SVBP. Reduced tyrosine carboxypeptidase activity. 1 Publication5
Mutagenesisi123Y → A: Reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi134R → A: Slightly reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi135K → A: Reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi154 – 155LP → EE: Disrupted interaction with SVBP. Reduced tyrosine carboxypeptidase activity. 1 Publication2
Mutagenesisi157K → A: Reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi158C → A: Abolished tyrosine carboxypeptidase activity. No effect on binding to microtubule. 2 Publications1
Mutagenesisi192H → A: No effect on tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi193H → A: Strongly reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi210S → A: Reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi211R → A or H: Reduced tyrosine carboxypeptidase activity. 1 Publication1
Mutagenesisi215L → A: Slightly reduced tyrosine carboxypeptidase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
79805

Open Targets

More...
OpenTargetsi
ENSG00000143494

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145147736

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q86V25, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VASH2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001899821 – 355Tubulinyl-Tyr carboxypeptidase 2Add BLAST355

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei302PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q86V25

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q86V25

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q86V25

PeptideAtlas

More...
PeptideAtlasi
Q86V25

PRoteomics IDEntifications database

More...
PRIDEi
Q86V25

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5557
69954 [Q86V25-1]
69955 [Q86V25-2]
69956 [Q86V25-3]
69957 [Q86V25-4]
69958 [Q86V25-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q86V25

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q86V25

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in various embryonic organs at 6 to 12 embryonic weeks. Detected in vessels from 20-week embryonic organs as well as in endothelial cells from large vessels in neonate.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By VEGF.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143494, Expressed in cortical plate and 146 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q86V25, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q86V25, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000143494, Tissue enhanced (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SVBP; interaction enhances VASH2 tyrosine carboxypeptidase activity.

3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122902, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q86V25, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000428324

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q86V25, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1355
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q86V25

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QPPX, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012703

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1577966_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q86V25

KEGG Orthology (KO)

More...
KOi
K23355

Identification of Orthologs from Complete Genome Data

More...
OMAi
FEIRKSR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q86V25

TreeFam database of animal gene trees

More...
TreeFami
TF329370

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028131, VASH1

The PANTHER Classification System

More...
PANTHERi
PTHR15750, PTHR15750, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14822, Vasohibin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q86V25-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGSAADTHR CPHPKGAKGT RSRSSHARPV SLATSGGSEE EDKDGGVLFH
60 70 80 90 100
VNKSGFPIDS HTWERMWMHV AKVHPKGGEM VGAIRNAAFL AKPSIPQVPN
110 120 130 140 150
YRLSMTIPDW LQAIQNYMKT LQYNHTGTQF FEIRKMRPLS GLMETAKEMT
160 170 180 190 200
RESLPIKCLE AVILGIYLTN GQPSIERFPI SFKTYFSGNY FHHVVLGIYC
210 220 230 240 250
NGRYGSLGMS RRAELMDKPL TFRTLSDLIF DFEDSYKKYL HTVKKVKIGL
260 270 280 290 300
YVPHEPHSFQ PIEWKQLVLN VSKMLRADIR KELEKYARDM RMKILKPASA
310 320 330 340 350
HSPTQVRSRG KSLSPRRRQA SPPRRLGRRE KSPALPEKKV ADLSTLNEVG

YQIRI
Length:355
Mass (Da):40,450
Last modified:April 12, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC74C313FEF6A0837
GO
Isoform 2 (identifier: Q86V25-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:290
Mass (Da):33,538
Checksum:i21042C9BB88CAB7B
GO
Isoform 3 (identifier: Q86V25-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-142: Missing.
     294-298: ILKPA → GLCSH
     299-355: Missing.

Show »
Length:156
Mass (Da):18,271
Checksum:i4F1B7393CD050DCE
GO
Isoform 4 (identifier: Q86V25-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-169: YLT → THS
     170-355: Missing.

Show »
Length:169
Mass (Da):18,753
Checksum:iE72AD1B6BB438113
GO
Isoform 5 (identifier: Q86V25-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-166: QYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGI → H

Show »
Length:311
Mass (Da):35,423
Checksum:iE7955D3D5C278530
GO
Isoform 6 (identifier: Q86V25-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.

Show »
Length:251
Mass (Da):29,253
Checksum:iDB53A4CBB725842F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JY36C9JY36_HUMAN
Tubulinyl-Tyr carboxypeptidase 2
VASH2
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0133291 – 142Missing in isoform 3. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_0541041 – 104Missing in isoform 6. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_0133281 – 65Missing in isoform 2. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_013334122 – 166QYNHT…VILGI → H in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_013332167 – 169YLT → THS in isoform 4. 1 Publication3
Alternative sequenceiVSP_013333170 – 355Missing in isoform 4. 1 PublicationAdd BLAST186
Alternative sequenceiVSP_013330294 – 298ILKPA → GLCSH in isoform 3. 1 Publication5
Alternative sequenceiVSP_013331299 – 355Missing in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY834202 mRNA Translation: AAX39752.1
AK022567 mRNA Translation: BAB14103.1
AK302675 mRNA Translation: BAG63907.1
AL592449 Genomic DNA No translation available.
BC028194 mRNA Translation: AAH28194.1
BC051856 mRNA Translation: AAH51856.1
BC053836 mRNA Translation: AAH53836.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1511.1 [Q86V25-5]
CCDS44315.1 [Q86V25-2]
CCDS44316.1 [Q86V25-6]
CCDS73026.1 [Q86V25-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129946.1, NM_001136474.2 [Q86V25-2]
NP_001129947.1, NM_001136475.2 [Q86V25-6]
NP_001287985.1, NM_001301056.1 [Q86V25-1]
NP_079025.2, NM_024749.4 [Q86V25-5]
XP_011508289.1, XM_011509987.2
XP_011508290.1, XM_011509988.2
XP_016857840.1, XM_017002351.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000366964; ENSP00000355931; ENSG00000143494 [Q86V25-4]
ENST00000366965; ENSP00000355932; ENSG00000143494 [Q86V25-5]
ENST00000366966; ENSP00000430319; ENSG00000143494 [Q86V25-2]
ENST00000366967; ENSP00000429040; ENSG00000143494 [Q86V25-6]
ENST00000366968; ENSP00000355935; ENSG00000143494 [Q86V25-2]
ENST00000517399; ENSP00000428324; ENSG00000143494 [Q86V25-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79805

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79805

UCSC genome browser

More...
UCSCi
uc001hju.3, human [Q86V25-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY834202 mRNA Translation: AAX39752.1
AK022567 mRNA Translation: BAB14103.1
AK302675 mRNA Translation: BAG63907.1
AL592449 Genomic DNA No translation available.
BC028194 mRNA Translation: AAH28194.1
BC051856 mRNA Translation: AAH51856.1
BC053836 mRNA Translation: AAH53836.1
CCDSiCCDS1511.1 [Q86V25-5]
CCDS44315.1 [Q86V25-2]
CCDS44316.1 [Q86V25-6]
CCDS73026.1 [Q86V25-1]
RefSeqiNP_001129946.1, NM_001136474.2 [Q86V25-2]
NP_001129947.1, NM_001136475.2 [Q86V25-6]
NP_001287985.1, NM_001301056.1 [Q86V25-1]
NP_079025.2, NM_024749.4 [Q86V25-5]
XP_011508289.1, XM_011509987.2
XP_011508290.1, XM_011509988.2
XP_016857840.1, XM_017002351.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6J4OX-ray2.30A46-296[»]
6J4PX-ray1.60A46-296[»]
6J4QX-ray2.70A/C/F/J46-296[»]
6J4SX-ray2.80A1-355[»]
6J4VX-ray2.10A46-296[»]
6QBYX-ray2.09A/C40-295[»]
SMRiQ86V25
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi122902, 3 interactors
IntActiQ86V25, 6 interactors
STRINGi9606.ENSP00000428324

PTM databases

iPTMnetiQ86V25
PhosphoSitePlusiQ86V25

Polymorphism and mutation databases

BioMutaiVASH2

Proteomic databases

EPDiQ86V25
jPOSTiQ86V25
MassIVEiQ86V25
PeptideAtlasiQ86V25
PRIDEiQ86V25
ProteomicsDBi5557
69954 [Q86V25-1]
69955 [Q86V25-2]
69956 [Q86V25-3]
69957 [Q86V25-4]
69958 [Q86V25-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
47116, 130 antibodies

Genome annotation databases

EnsembliENST00000366964; ENSP00000355931; ENSG00000143494 [Q86V25-4]
ENST00000366965; ENSP00000355932; ENSG00000143494 [Q86V25-5]
ENST00000366966; ENSP00000430319; ENSG00000143494 [Q86V25-2]
ENST00000366967; ENSP00000429040; ENSG00000143494 [Q86V25-6]
ENST00000366968; ENSP00000355935; ENSG00000143494 [Q86V25-2]
ENST00000517399; ENSP00000428324; ENSG00000143494 [Q86V25-1]
GeneIDi79805
KEGGihsa:79805
UCSCiuc001hju.3, human [Q86V25-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79805
DisGeNETi79805
EuPathDBiHostDB:ENSG00000143494.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VASH2
HGNCiHGNC:25723, VASH2
HPAiENSG00000143494, Tissue enhanced (testis)
MIMi610471, gene
neXtProtiNX_Q86V25
OpenTargetsiENSG00000143494
PharmGKBiPA145147736

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QPPX, Eukaryota
GeneTreeiENSGT00390000012703
HOGENOMiCLU_1577966_0_0_1
InParanoidiQ86V25
KOiK23355
OMAiFEIRKSR
PhylomeDBiQ86V25
TreeFamiTF329370

Enzyme and pathway databases

PathwayCommonsiQ86V25

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79805, 5 hits in 871 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79805
PharosiQ86V25, Tbio

Protein Ontology

More...
PROi
PR:Q86V25
RNActiQ86V25, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143494, Expressed in cortical plate and 146 other tissues
ExpressionAtlasiQ86V25, baseline and differential
GenevisibleiQ86V25, HS

Family and domain databases

InterProiView protein in InterPro
IPR028131, VASH1
PANTHERiPTHR15750, PTHR15750, 1 hit
PfamiView protein in Pfam
PF14822, Vasohibin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVASH2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q86V25
Secondary accession number(s): B4DYZ5
, Q2VT46, Q5VTE7, Q5VTE9, Q7Z6E3, Q8IZ24, Q9H9W5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 12, 2005
Last modified: August 12, 2020
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again